Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3K472

Protein Details
Accession E3K472    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-72PTERQHPSHCPPRPPKGPRRLBasic
NLS Segment(s)
PositionSequence
64-71RPPKGPRR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
KEGG pgr:PGTG_05403  -  
Amino Acid Sequences MPRTLGYRLERSDCARNGPLTPQRPRIVVRRSRTNRIVVGQPRRAPSAPEHPTERQHPSHCPPRPPKGPRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.39
4 0.36
5 0.4
6 0.43
7 0.43
8 0.47
9 0.48
10 0.47
11 0.48
12 0.49
13 0.5
14 0.51
15 0.52
16 0.52
17 0.56
18 0.59
19 0.64
20 0.65
21 0.6
22 0.53
23 0.47
24 0.48
25 0.44
26 0.47
27 0.45
28 0.45
29 0.43
30 0.45
31 0.43
32 0.37
33 0.35
34 0.37
35 0.35
36 0.36
37 0.39
38 0.39
39 0.44
40 0.47
41 0.49
42 0.44
43 0.44
44 0.48
45 0.51
46 0.58
47 0.6
48 0.65
49 0.67
50 0.71
51 0.78
52 0.8