Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QS29

Protein Details
Accession H6QS29    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
42-63AKCPECKKSTKREHYDRLRQGGBasic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
KEGG pgr:PGTG_21605  -  
Amino Acid Sequences MRAWMYTLPLLLTTLLPGCTTGLPMQAPEHLSQQATELVAPAKCPECKKSTKREHYDRLRQGGVLLARIRPLEKMLRRSLSHSLPCGHAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.1
8 0.1
9 0.11
10 0.1
11 0.11
12 0.12
13 0.13
14 0.15
15 0.14
16 0.16
17 0.15
18 0.15
19 0.14
20 0.14
21 0.13
22 0.11
23 0.1
24 0.08
25 0.09
26 0.09
27 0.09
28 0.09
29 0.1
30 0.12
31 0.14
32 0.17
33 0.2
34 0.29
35 0.35
36 0.45
37 0.53
38 0.61
39 0.69
40 0.75
41 0.8
42 0.81
43 0.86
44 0.82
45 0.76
46 0.66
47 0.57
48 0.48
49 0.42
50 0.33
51 0.27
52 0.21
53 0.17
54 0.17
55 0.18
56 0.18
57 0.15
58 0.18
59 0.23
60 0.28
61 0.35
62 0.41
63 0.47
64 0.48
65 0.52
66 0.56
67 0.55
68 0.54
69 0.51
70 0.46