Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3LBS4

Protein Details
Accession E3LBS4    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
15-45MQCKSYQPPNVPKHSRKPKPNVRYQTPPHSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
KEGG pgr:PGTG_20015  -  
Amino Acid Sequences MIKRFEFEKRPREAMQCKSYQPPNVPKHSRKPKPNVRYQTPPHSFESDHPFIEAVEHNEPGLNEPADGRDVYDESGLGDNLNEEYRSDCNVLDDECPSNLDEHVDDLPEEEQASETVSACYYGRDNLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.62
4 0.59
5 0.6
6 0.62
7 0.59
8 0.59
9 0.6
10 0.6
11 0.65
12 0.7
13 0.7
14 0.75
15 0.8
16 0.81
17 0.81
18 0.84
19 0.85
20 0.85
21 0.88
22 0.87
23 0.83
24 0.84
25 0.8
26 0.8
27 0.75
28 0.69
29 0.61
30 0.55
31 0.48
32 0.42
33 0.45
34 0.36
35 0.31
36 0.27
37 0.24
38 0.2
39 0.21
40 0.18
41 0.13
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.13
49 0.09
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.05
66 0.05
67 0.06
68 0.07
69 0.06
70 0.05
71 0.07
72 0.08
73 0.11
74 0.11
75 0.11
76 0.11
77 0.12
78 0.13
79 0.13
80 0.14
81 0.13
82 0.12
83 0.13
84 0.12
85 0.12
86 0.11
87 0.12
88 0.1
89 0.11
90 0.11
91 0.11
92 0.1
93 0.11
94 0.11
95 0.1
96 0.1
97 0.08
98 0.08
99 0.07
100 0.1
101 0.09
102 0.09
103 0.1
104 0.1
105 0.11
106 0.1
107 0.12
108 0.12