Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KE58

Protein Details
Accession E3KE58    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-36DQHKRACKDRYYRQALKRESHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 8, mito 4, nucl 3.5, pero 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pgr:PGTG_08796  -  
Amino Acid Sequences MEETIGAEAMQALDVLDQHKRACKDRYYRQALKRESQKARYVDTYSKVNSLKQLVAKDRGFQVTVRHPRLWYLLDTDVGRPIQNLGTPPTPRWDAQGQLGLTLREKPLLLLFFFCLSLALLFFVIFAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.1
4 0.11
5 0.13
6 0.19
7 0.23
8 0.28
9 0.34
10 0.41
11 0.48
12 0.57
13 0.66
14 0.7
15 0.75
16 0.78
17 0.81
18 0.78
19 0.77
20 0.76
21 0.75
22 0.73
23 0.7
24 0.69
25 0.62
26 0.61
27 0.56
28 0.51
29 0.45
30 0.41
31 0.39
32 0.32
33 0.34
34 0.31
35 0.28
36 0.27
37 0.25
38 0.24
39 0.23
40 0.26
41 0.25
42 0.31
43 0.3
44 0.29
45 0.28
46 0.27
47 0.24
48 0.21
49 0.21
50 0.24
51 0.31
52 0.34
53 0.33
54 0.32
55 0.32
56 0.34
57 0.32
58 0.23
59 0.19
60 0.16
61 0.17
62 0.18
63 0.17
64 0.17
65 0.16
66 0.15
67 0.11
68 0.11
69 0.1
70 0.1
71 0.11
72 0.13
73 0.18
74 0.19
75 0.2
76 0.23
77 0.25
78 0.24
79 0.27
80 0.26
81 0.23
82 0.25
83 0.31
84 0.26
85 0.26
86 0.27
87 0.23
88 0.22
89 0.22
90 0.19
91 0.15
92 0.15
93 0.13
94 0.16
95 0.18
96 0.17
97 0.16
98 0.17
99 0.17
100 0.17
101 0.16
102 0.12
103 0.11
104 0.1
105 0.09
106 0.08
107 0.07
108 0.07