Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L294

Protein Details
Accession E3L294   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
333-353GAAKEEKPKLKKKKIVDDDDEBasic
377-421EEDQLPKSKKRKLSKKAAEKSKKNGKSKAKERKSAKEKKQEEEEEBasic
NLS Segment(s)
PositionSequence
333-346GAAKEEKPKLKKKK
383-415KSKKRKLSKKAAEKSKKNGKSKAKERKSAKEKK
Subcellular Location(s) nucl 18.5, mito_nucl 12, mito 4.5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR000730  Pr_cel_nuc_antig  
IPR022649  Pr_cel_nuc_antig_C  
IPR022659  Pr_cel_nuc_antig_CS  
IPR022648  Pr_cel_nuc_antig_N  
Gene Ontology GO:0043626  C:PCNA complex  
GO:0003677  F:DNA binding  
GO:0030337  F:DNA polymerase processivity factor activity  
GO:0006272  P:leading strand elongation  
GO:0006298  P:mismatch repair  
GO:0006275  P:regulation of DNA replication  
GO:0019985  P:translesion synthesis  
KEGG pgr:PGTG_16695  -  
Pfam View protein in Pfam  
PF02747  PCNA_C  
PF00705  PCNA_N  
PROSITE View protein in PROSITE  
PS01251  PCNA_1  
CDD cd00577  PCNA  
Amino Acid Sequences MCGVGSLMVSGSRRASLTAGSALGPSPPLERVRLHSQQHPSQGEPTVSWLQDFHPPQPPHLLSYPSAIMFEAKLNQAGLLKSVLDAIRELVTDVNFNCDEDGMKLQAMDNSHVALVALQLRASGFGQYRCDRQMTLGINVPSFQKITKCAAPQDIITLRAFDDGDVLNIVAETLNTDRVAEYEMKMMDIDIEHLGIPETRYDAEVTLPSSEFNRIIRDLKEMGESIRIEATKEGVTFVTNGDIGKGSVTLKHNADEKKTLKVDKDKDVIDIDSDEEKDEEQNDDEGSDGDAEERKLKKALFKKDPDEDPSQNATQETDDEMDESQDVKPKTNGAAKEEKPKLKKKKIVDDDDEEEEADEQQKDAENDEEADEDEEDEEDQLPKSKKRKLSKKAAEKSKKNGKSKAKERKSAKEKKQEEEEEDLSVSISLQQSVSLTFSIKYLSNFTKATPLAKRLTLHMSNEVPLLVAYEFDTGYVRYYLAPKIEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.17
5 0.18
6 0.17
7 0.16
8 0.16
9 0.15
10 0.15
11 0.14
12 0.12
13 0.11
14 0.15
15 0.17
16 0.2
17 0.22
18 0.28
19 0.36
20 0.44
21 0.47
22 0.5
23 0.57
24 0.6
25 0.67
26 0.64
27 0.57
28 0.53
29 0.52
30 0.46
31 0.37
32 0.37
33 0.33
34 0.29
35 0.27
36 0.24
37 0.22
38 0.29
39 0.31
40 0.29
41 0.34
42 0.35
43 0.37
44 0.45
45 0.44
46 0.41
47 0.42
48 0.41
49 0.32
50 0.35
51 0.35
52 0.26
53 0.25
54 0.2
55 0.17
56 0.15
57 0.16
58 0.15
59 0.14
60 0.14
61 0.14
62 0.15
63 0.17
64 0.16
65 0.15
66 0.13
67 0.12
68 0.11
69 0.14
70 0.13
71 0.12
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.11
78 0.11
79 0.12
80 0.12
81 0.16
82 0.15
83 0.15
84 0.15
85 0.13
86 0.13
87 0.13
88 0.15
89 0.11
90 0.11
91 0.11
92 0.12
93 0.14
94 0.15
95 0.15
96 0.13
97 0.13
98 0.13
99 0.12
100 0.11
101 0.09
102 0.09
103 0.1
104 0.09
105 0.08
106 0.08
107 0.08
108 0.1
109 0.1
110 0.12
111 0.11
112 0.14
113 0.2
114 0.22
115 0.26
116 0.27
117 0.28
118 0.25
119 0.24
120 0.29
121 0.26
122 0.26
123 0.28
124 0.27
125 0.25
126 0.26
127 0.25
128 0.19
129 0.17
130 0.15
131 0.12
132 0.14
133 0.19
134 0.23
135 0.25
136 0.27
137 0.3
138 0.3
139 0.28
140 0.31
141 0.28
142 0.25
143 0.22
144 0.2
145 0.17
146 0.17
147 0.16
148 0.1
149 0.1
150 0.08
151 0.08
152 0.08
153 0.08
154 0.06
155 0.06
156 0.06
157 0.04
158 0.03
159 0.04
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.1
167 0.09
168 0.09
169 0.11
170 0.11
171 0.11
172 0.11
173 0.11
174 0.09
175 0.08
176 0.09
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.05
185 0.06
186 0.06
187 0.07
188 0.07
189 0.07
190 0.08
191 0.09
192 0.09
193 0.09
194 0.09
195 0.09
196 0.09
197 0.1
198 0.1
199 0.1
200 0.12
201 0.13
202 0.15
203 0.16
204 0.18
205 0.18
206 0.18
207 0.18
208 0.16
209 0.15
210 0.16
211 0.15
212 0.12
213 0.13
214 0.12
215 0.11
216 0.11
217 0.12
218 0.09
219 0.09
220 0.09
221 0.07
222 0.08
223 0.08
224 0.08
225 0.07
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.05
232 0.06
233 0.05
234 0.09
235 0.11
236 0.14
237 0.14
238 0.17
239 0.22
240 0.23
241 0.25
242 0.28
243 0.28
244 0.31
245 0.33
246 0.33
247 0.32
248 0.39
249 0.42
250 0.41
251 0.43
252 0.38
253 0.37
254 0.36
255 0.31
256 0.23
257 0.19
258 0.14
259 0.11
260 0.11
261 0.09
262 0.08
263 0.08
264 0.08
265 0.09
266 0.08
267 0.08
268 0.08
269 0.08
270 0.08
271 0.08
272 0.07
273 0.07
274 0.06
275 0.05
276 0.05
277 0.07
278 0.07
279 0.13
280 0.14
281 0.15
282 0.17
283 0.18
284 0.25
285 0.32
286 0.42
287 0.46
288 0.51
289 0.56
290 0.6
291 0.63
292 0.61
293 0.59
294 0.51
295 0.46
296 0.43
297 0.38
298 0.32
299 0.29
300 0.24
301 0.18
302 0.17
303 0.13
304 0.1
305 0.09
306 0.09
307 0.09
308 0.09
309 0.09
310 0.09
311 0.08
312 0.13
313 0.13
314 0.14
315 0.15
316 0.16
317 0.21
318 0.25
319 0.27
320 0.27
321 0.36
322 0.37
323 0.47
324 0.53
325 0.56
326 0.58
327 0.66
328 0.71
329 0.72
330 0.76
331 0.75
332 0.79
333 0.81
334 0.83
335 0.79
336 0.75
337 0.69
338 0.65
339 0.56
340 0.45
341 0.35
342 0.27
343 0.2
344 0.16
345 0.12
346 0.08
347 0.08
348 0.11
349 0.11
350 0.12
351 0.13
352 0.11
353 0.12
354 0.13
355 0.12
356 0.11
357 0.11
358 0.1
359 0.09
360 0.08
361 0.08
362 0.07
363 0.07
364 0.08
365 0.08
366 0.08
367 0.14
368 0.18
369 0.24
370 0.31
371 0.38
372 0.47
373 0.57
374 0.67
375 0.71
376 0.79
377 0.84
378 0.88
379 0.9
380 0.92
381 0.92
382 0.89
383 0.89
384 0.89
385 0.87
386 0.84
387 0.84
388 0.83
389 0.83
390 0.87
391 0.88
392 0.86
393 0.87
394 0.86
395 0.88
396 0.88
397 0.88
398 0.87
399 0.87
400 0.84
401 0.82
402 0.84
403 0.79
404 0.74
405 0.7
406 0.61
407 0.52
408 0.46
409 0.38
410 0.28
411 0.22
412 0.16
413 0.12
414 0.11
415 0.1
416 0.09
417 0.1
418 0.1
419 0.11
420 0.13
421 0.1
422 0.1
423 0.1
424 0.1
425 0.12
426 0.14
427 0.15
428 0.19
429 0.22
430 0.26
431 0.26
432 0.27
433 0.33
434 0.32
435 0.37
436 0.37
437 0.4
438 0.39
439 0.43
440 0.44
441 0.4
442 0.47
443 0.46
444 0.43
445 0.44
446 0.42
447 0.39
448 0.38
449 0.33
450 0.25
451 0.19
452 0.18
453 0.11
454 0.09
455 0.09
456 0.09
457 0.09
458 0.09
459 0.11
460 0.09
461 0.12
462 0.12
463 0.12
464 0.13
465 0.16
466 0.2
467 0.22