Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KLY1

Protein Details
Accession E3KLY1   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-31CIAGDGKKMKKTRREKKAKVGGGIBasic
NLS Segment(s)
PositionSequence
13-30GKKMKKTRREKKAKVGGG
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 7
Family & Domain DBs
KEGG pgr:PGTG_11499  -  
Amino Acid Sequences MSTGMASCIAGDGKKMKKTRREKKAKVGGGIMNGEIKNGEIKKKVFLKEEQRQLGTVNQNNLALPHHHPSHPTTTTSVSSTSQPPPPPSHDLHLRHPARLAPRPSKNSNRPSIHLFDKLTGGGLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.45
4 0.54
5 0.65
6 0.73
7 0.77
8 0.82
9 0.84
10 0.88
11 0.9
12 0.86
13 0.78
14 0.73
15 0.64
16 0.57
17 0.49
18 0.38
19 0.31
20 0.25
21 0.21
22 0.15
23 0.13
24 0.15
25 0.15
26 0.18
27 0.18
28 0.2
29 0.26
30 0.33
31 0.36
32 0.35
33 0.41
34 0.47
35 0.52
36 0.59
37 0.56
38 0.5
39 0.47
40 0.44
41 0.42
42 0.39
43 0.33
44 0.26
45 0.23
46 0.23
47 0.22
48 0.21
49 0.17
50 0.13
51 0.12
52 0.14
53 0.15
54 0.15
55 0.17
56 0.19
57 0.24
58 0.24
59 0.23
60 0.21
61 0.22
62 0.23
63 0.23
64 0.22
65 0.17
66 0.17
67 0.19
68 0.21
69 0.23
70 0.24
71 0.27
72 0.29
73 0.33
74 0.36
75 0.35
76 0.37
77 0.42
78 0.43
79 0.47
80 0.54
81 0.5
82 0.46
83 0.45
84 0.43
85 0.41
86 0.45
87 0.46
88 0.45
89 0.53
90 0.6
91 0.67
92 0.73
93 0.76
94 0.77
95 0.79
96 0.75
97 0.7
98 0.69
99 0.66
100 0.61
101 0.57
102 0.5
103 0.42
104 0.38
105 0.34
106 0.29
107 0.24