Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JWJ6

Protein Details
Accession E3JWJ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
430-459NLPVCNTKDRGVRKKLKHHTTPKACRTAGGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 5, E.R. 5, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pgr:PGTG_02862  -  
Amino Acid Sequences MPFLSKLLLMQTILKPLLISVIAANNGQALQVYPSRKPSSLSHVLHPRGEFAAGAEYIPSLDAKPLAPYECAPKPLVPQTWKDLRIDEYLKYYPRGLEVNLTTFASQNKALNFACGLSQFCSAGQLCSPISGRAWWVLAAVEQLSFYENSLYIAIAFAATIGAKLVDDLYIQNAKKKYKLFQSIAMVLTLAMGIVSVMAGVVFMVTPGLQGLGVMAAAGAVVAIAQVTMVMKAQAAELEAGKQDTFTKWAHYENQIATWQSNTQKEIGIKFKEIVEYPISSRRGIFGALEGGQFCRNNQKQDTNDMEKNLARILTIRMAGQILRAKKGFITIGDGCSQNGPNGAFSIDDGWLSYCDKRDGVMMNVIYDDDGKSGNHFYNAKLLVEKYQITAEYITKQAVDCSKLGKGPDYDPYSDGTNLPLDVNSPCLINLPVCNTKDRGVRKKLKHHTTPKACRTAGGMSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.19
4 0.21
5 0.16
6 0.14
7 0.1
8 0.13
9 0.14
10 0.15
11 0.14
12 0.13
13 0.12
14 0.12
15 0.1
16 0.07
17 0.1
18 0.15
19 0.19
20 0.21
21 0.3
22 0.34
23 0.35
24 0.38
25 0.39
26 0.43
27 0.49
28 0.49
29 0.5
30 0.56
31 0.58
32 0.59
33 0.55
34 0.48
35 0.39
36 0.36
37 0.27
38 0.18
39 0.19
40 0.15
41 0.14
42 0.12
43 0.1
44 0.1
45 0.1
46 0.1
47 0.06
48 0.07
49 0.08
50 0.09
51 0.12
52 0.14
53 0.15
54 0.16
55 0.17
56 0.23
57 0.26
58 0.28
59 0.28
60 0.27
61 0.31
62 0.37
63 0.43
64 0.4
65 0.41
66 0.45
67 0.52
68 0.52
69 0.48
70 0.43
71 0.39
72 0.42
73 0.4
74 0.34
75 0.31
76 0.34
77 0.34
78 0.34
79 0.32
80 0.26
81 0.26
82 0.26
83 0.21
84 0.23
85 0.23
86 0.24
87 0.24
88 0.24
89 0.21
90 0.21
91 0.21
92 0.17
93 0.17
94 0.17
95 0.16
96 0.2
97 0.2
98 0.2
99 0.19
100 0.17
101 0.16
102 0.15
103 0.16
104 0.12
105 0.14
106 0.13
107 0.12
108 0.15
109 0.14
110 0.14
111 0.13
112 0.13
113 0.12
114 0.14
115 0.15
116 0.12
117 0.13
118 0.13
119 0.13
120 0.12
121 0.13
122 0.11
123 0.1
124 0.09
125 0.09
126 0.09
127 0.08
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.06
134 0.07
135 0.06
136 0.07
137 0.08
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.07
157 0.13
158 0.13
159 0.18
160 0.22
161 0.24
162 0.28
163 0.31
164 0.34
165 0.38
166 0.47
167 0.44
168 0.46
169 0.49
170 0.48
171 0.45
172 0.39
173 0.3
174 0.21
175 0.18
176 0.12
177 0.07
178 0.03
179 0.02
180 0.02
181 0.02
182 0.02
183 0.01
184 0.01
185 0.01
186 0.02
187 0.01
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.01
207 0.01
208 0.01
209 0.01
210 0.01
211 0.01
212 0.01
213 0.02
214 0.02
215 0.02
216 0.02
217 0.03
218 0.03
219 0.03
220 0.04
221 0.04
222 0.04
223 0.05
224 0.05
225 0.05
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.1
233 0.09
234 0.12
235 0.13
236 0.16
237 0.18
238 0.2
239 0.24
240 0.21
241 0.23
242 0.22
243 0.21
244 0.19
245 0.16
246 0.17
247 0.17
248 0.19
249 0.17
250 0.17
251 0.19
252 0.2
253 0.23
254 0.26
255 0.24
256 0.23
257 0.23
258 0.23
259 0.22
260 0.21
261 0.2
262 0.16
263 0.15
264 0.16
265 0.22
266 0.23
267 0.21
268 0.21
269 0.19
270 0.18
271 0.17
272 0.15
273 0.09
274 0.1
275 0.1
276 0.11
277 0.1
278 0.1
279 0.12
280 0.12
281 0.12
282 0.2
283 0.22
284 0.27
285 0.31
286 0.37
287 0.37
288 0.45
289 0.52
290 0.49
291 0.49
292 0.45
293 0.43
294 0.37
295 0.35
296 0.28
297 0.21
298 0.14
299 0.12
300 0.13
301 0.13
302 0.13
303 0.13
304 0.12
305 0.13
306 0.13
307 0.16
308 0.18
309 0.17
310 0.2
311 0.2
312 0.2
313 0.2
314 0.22
315 0.19
316 0.15
317 0.2
318 0.18
319 0.2
320 0.22
321 0.22
322 0.2
323 0.21
324 0.2
325 0.14
326 0.15
327 0.13
328 0.11
329 0.12
330 0.12
331 0.09
332 0.09
333 0.11
334 0.09
335 0.08
336 0.08
337 0.08
338 0.09
339 0.11
340 0.12
341 0.13
342 0.14
343 0.14
344 0.14
345 0.17
346 0.18
347 0.19
348 0.23
349 0.21
350 0.2
351 0.2
352 0.19
353 0.16
354 0.15
355 0.12
356 0.07
357 0.08
358 0.07
359 0.09
360 0.12
361 0.13
362 0.17
363 0.18
364 0.18
365 0.25
366 0.26
367 0.26
368 0.25
369 0.25
370 0.24
371 0.27
372 0.27
373 0.2
374 0.21
375 0.2
376 0.2
377 0.21
378 0.19
379 0.19
380 0.19
381 0.18
382 0.17
383 0.17
384 0.19
385 0.21
386 0.22
387 0.2
388 0.22
389 0.24
390 0.26
391 0.27
392 0.28
393 0.27
394 0.27
395 0.35
396 0.37
397 0.36
398 0.34
399 0.35
400 0.33
401 0.31
402 0.28
403 0.22
404 0.18
405 0.17
406 0.16
407 0.14
408 0.13
409 0.12
410 0.15
411 0.13
412 0.12
413 0.11
414 0.13
415 0.14
416 0.14
417 0.16
418 0.2
419 0.28
420 0.29
421 0.33
422 0.33
423 0.38
424 0.44
425 0.52
426 0.55
427 0.58
428 0.67
429 0.73
430 0.82
431 0.87
432 0.89
433 0.9
434 0.91
435 0.91
436 0.92
437 0.93
438 0.92
439 0.91
440 0.8
441 0.71
442 0.65