Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3L381

Protein Details
Accession E3L381    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
26-48VSNCKPQHPHSKKPKHGDLNPRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
KEGG pgr:PGTG_17278  -  
Amino Acid Sequences MVIQATKTLDVNLDPSVQDIEGFAYVSNCKPQHPHSKKPKHGDLNPRSIAFFSWNICAHYFNVTPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.11
5 0.1
6 0.08
7 0.08
8 0.07
9 0.07
10 0.06
11 0.06
12 0.07
13 0.08
14 0.13
15 0.13
16 0.13
17 0.16
18 0.22
19 0.32
20 0.38
21 0.48
22 0.54
23 0.64
24 0.72
25 0.77
26 0.81
27 0.78
28 0.79
29 0.8
30 0.76
31 0.75
32 0.71
33 0.63
34 0.54
35 0.45
36 0.39
37 0.31
38 0.26
39 0.18
40 0.2
41 0.21
42 0.23
43 0.23
44 0.24
45 0.21
46 0.24