Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KMP3

Protein Details
Accession E3KMP3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
236-260GCSNCGKRGHKSSECRKPKTKAGAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, nucl 8, cyto_mito 7.5, mito 4.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG pgr:PGTG_11924  -  
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MLTCQVQNVASLVSTVKALDGTAAVFPVWRSCIEDVLSMQNTLKIVNGSLPRPKEDSKSDSLVARSMDYSKGYNPKEVVADWDALSELACATIRLTLSRPLALRYRKTKPATRLFTTIVNAYEKNTRARRIRLQEAFWESKHDPNTPIALWIGHVRVAADELLTINELPTDRHIADRLVAGLDSSWSAVKDSIVYTAQEMSLDDTIGALEAHEVSLNGKTSTDFASASFASSKRFGCSNCGKRGHKSSECRKPKTKAGAVSTVKLGGYDSGSFDDGDEIDVLYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.07
12 0.08
13 0.08
14 0.1
15 0.11
16 0.11
17 0.14
18 0.15
19 0.18
20 0.19
21 0.21
22 0.2
23 0.25
24 0.26
25 0.22
26 0.22
27 0.21
28 0.19
29 0.17
30 0.17
31 0.11
32 0.1
33 0.15
34 0.19
35 0.21
36 0.27
37 0.29
38 0.31
39 0.35
40 0.38
41 0.38
42 0.41
43 0.43
44 0.42
45 0.44
46 0.43
47 0.41
48 0.39
49 0.36
50 0.3
51 0.25
52 0.21
53 0.18
54 0.18
55 0.16
56 0.17
57 0.19
58 0.27
59 0.27
60 0.3
61 0.29
62 0.29
63 0.29
64 0.28
65 0.27
66 0.21
67 0.21
68 0.17
69 0.16
70 0.14
71 0.13
72 0.12
73 0.08
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.06
80 0.07
81 0.08
82 0.09
83 0.14
84 0.15
85 0.18
86 0.18
87 0.19
88 0.26
89 0.3
90 0.36
91 0.38
92 0.43
93 0.49
94 0.54
95 0.59
96 0.6
97 0.65
98 0.65
99 0.62
100 0.59
101 0.52
102 0.5
103 0.44
104 0.36
105 0.28
106 0.23
107 0.19
108 0.17
109 0.19
110 0.18
111 0.24
112 0.26
113 0.3
114 0.33
115 0.38
116 0.45
117 0.47
118 0.54
119 0.51
120 0.49
121 0.49
122 0.5
123 0.47
124 0.39
125 0.38
126 0.3
127 0.31
128 0.31
129 0.27
130 0.22
131 0.21
132 0.23
133 0.17
134 0.17
135 0.13
136 0.11
137 0.1
138 0.1
139 0.09
140 0.08
141 0.08
142 0.07
143 0.07
144 0.07
145 0.07
146 0.05
147 0.05
148 0.04
149 0.04
150 0.05
151 0.05
152 0.04
153 0.05
154 0.05
155 0.05
156 0.07
157 0.1
158 0.1
159 0.11
160 0.12
161 0.12
162 0.12
163 0.12
164 0.12
165 0.09
166 0.08
167 0.07
168 0.06
169 0.06
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.07
179 0.09
180 0.1
181 0.1
182 0.1
183 0.11
184 0.1
185 0.1
186 0.09
187 0.09
188 0.09
189 0.08
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.08
203 0.09
204 0.09
205 0.09
206 0.1
207 0.11
208 0.14
209 0.14
210 0.12
211 0.11
212 0.15
213 0.15
214 0.16
215 0.17
216 0.15
217 0.17
218 0.2
219 0.2
220 0.19
221 0.22
222 0.22
223 0.27
224 0.38
225 0.44
226 0.5
227 0.58
228 0.6
229 0.64
230 0.72
231 0.74
232 0.72
233 0.73
234 0.75
235 0.77
236 0.83
237 0.84
238 0.84
239 0.81
240 0.81
241 0.82
242 0.78
243 0.76
244 0.72
245 0.74
246 0.69
247 0.65
248 0.57
249 0.48
250 0.4
251 0.31
252 0.26
253 0.17
254 0.16
255 0.14
256 0.14
257 0.14
258 0.15
259 0.15
260 0.15
261 0.15
262 0.12
263 0.13
264 0.11