Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KSS3

Protein Details
Accession E3KSS3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
101-125RRMMRKPTRGTRQKQQRPRSRTLKEBasic
NLS Segment(s)
PositionSequence
104-119MRKPTRGTRQKQQRPR
Subcellular Location(s) mito_nucl 10.166, cyto_nucl 9.833, nucl 9.5, mito 9.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0032040  C:small-subunit processome  
GO:0003735  F:structural constituent of ribosome  
GO:0042274  P:ribosomal small subunit biogenesis  
GO:0006364  P:rRNA processing  
GO:0006412  P:translation  
KEGG pgr:PGTG_13681  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAQTKILRTANAPRTTPDETELMVAQAILDLETNVPDLNAELRPLQISAAREVEVKGGRKAIVIFVPVPQVKAFHKVQGRLTRELEKKFSDRHVVFIGQRRMMRKPTRGTRQKQQRPRSRTLKEVHEKILEDLVYPTEITGKRIRFHTDGSKVMKVFLDSKDATSLEYKLDSFSSVYHRLTGKTVHFEFPTVQEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.49
4 0.46
5 0.39
6 0.31
7 0.25
8 0.26
9 0.24
10 0.18
11 0.14
12 0.12
13 0.09
14 0.08
15 0.07
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.06
26 0.08
27 0.08
28 0.09
29 0.09
30 0.1
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.14
37 0.15
38 0.15
39 0.15
40 0.15
41 0.19
42 0.2
43 0.21
44 0.19
45 0.2
46 0.19
47 0.2
48 0.2
49 0.17
50 0.14
51 0.14
52 0.13
53 0.12
54 0.17
55 0.16
56 0.17
57 0.15
58 0.16
59 0.15
60 0.2
61 0.2
62 0.21
63 0.24
64 0.27
65 0.34
66 0.4
67 0.43
68 0.42
69 0.44
70 0.46
71 0.47
72 0.47
73 0.43
74 0.38
75 0.36
76 0.34
77 0.34
78 0.34
79 0.3
80 0.3
81 0.28
82 0.27
83 0.27
84 0.32
85 0.33
86 0.27
87 0.29
88 0.29
89 0.3
90 0.35
91 0.38
92 0.37
93 0.43
94 0.48
95 0.57
96 0.64
97 0.67
98 0.69
99 0.75
100 0.79
101 0.8
102 0.82
103 0.81
104 0.8
105 0.84
106 0.84
107 0.76
108 0.74
109 0.69
110 0.69
111 0.68
112 0.64
113 0.58
114 0.51
115 0.48
116 0.41
117 0.39
118 0.28
119 0.2
120 0.17
121 0.14
122 0.11
123 0.1
124 0.09
125 0.12
126 0.12
127 0.15
128 0.2
129 0.23
130 0.25
131 0.28
132 0.34
133 0.3
134 0.35
135 0.4
136 0.4
137 0.44
138 0.47
139 0.48
140 0.43
141 0.42
142 0.38
143 0.31
144 0.29
145 0.24
146 0.25
147 0.21
148 0.23
149 0.25
150 0.24
151 0.23
152 0.22
153 0.21
154 0.16
155 0.17
156 0.16
157 0.14
158 0.14
159 0.14
160 0.13
161 0.14
162 0.19
163 0.22
164 0.22
165 0.25
166 0.26
167 0.27
168 0.29
169 0.32
170 0.31
171 0.35
172 0.37
173 0.37
174 0.36
175 0.37
176 0.36