Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L920

Protein Details
Accession E3L920    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-64DDEPSRRQRARTDHCRRQQARTDQRRRQQARTDQRRRQQARTDQRRRQQARTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
KEGG pgr:PGTG_18667  -  
Amino Acid Sequences MDIPQRSPSDTDDEPSRRQRARTDHCRRQQARTDQRRRQQARTDQRRRQQARTDQRRRQQARTDHQASKLVNPFLDIDRPASDEELPAPETLDGTRPPAKLLTVALGAQIPQPEHTTIILSTLAAVLKRLNTLTQKQSPQNPLELPTAANLSLAKQIRIFQFSPEAKVSPYIPFPPPRTTPVLPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.54
4 0.51
5 0.54
6 0.57
7 0.59
8 0.65
9 0.7
10 0.72
11 0.75
12 0.8
13 0.88
14 0.83
15 0.81
16 0.8
17 0.8
18 0.81
19 0.81
20 0.83
21 0.81
22 0.86
23 0.88
24 0.84
25 0.81
26 0.8
27 0.79
28 0.8
29 0.82
30 0.85
31 0.83
32 0.85
33 0.88
34 0.84
35 0.81
36 0.8
37 0.79
38 0.8
39 0.82
40 0.85
41 0.83
42 0.85
43 0.88
44 0.84
45 0.81
46 0.79
47 0.78
48 0.76
49 0.76
50 0.75
51 0.67
52 0.63
53 0.61
54 0.52
55 0.48
56 0.45
57 0.35
58 0.28
59 0.26
60 0.25
61 0.2
62 0.21
63 0.16
64 0.12
65 0.12
66 0.13
67 0.13
68 0.12
69 0.11
70 0.09
71 0.1
72 0.1
73 0.1
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.08
80 0.07
81 0.1
82 0.14
83 0.13
84 0.14
85 0.14
86 0.14
87 0.13
88 0.13
89 0.11
90 0.09
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.09
100 0.09
101 0.1
102 0.1
103 0.1
104 0.09
105 0.1
106 0.09
107 0.08
108 0.07
109 0.07
110 0.08
111 0.06
112 0.07
113 0.06
114 0.07
115 0.08
116 0.09
117 0.11
118 0.16
119 0.21
120 0.28
121 0.34
122 0.4
123 0.44
124 0.51
125 0.54
126 0.51
127 0.5
128 0.44
129 0.41
130 0.37
131 0.33
132 0.26
133 0.21
134 0.21
135 0.16
136 0.15
137 0.12
138 0.1
139 0.17
140 0.17
141 0.17
142 0.17
143 0.21
144 0.24
145 0.29
146 0.28
147 0.24
148 0.33
149 0.33
150 0.37
151 0.35
152 0.33
153 0.29
154 0.31
155 0.3
156 0.24
157 0.27
158 0.27
159 0.3
160 0.36
161 0.4
162 0.45
163 0.47
164 0.48
165 0.52