Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KG31

Protein Details
Accession E3KG31    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
234-254APVPAAKKSKKSKTHDSEEEPHydrophilic
NLS Segment(s)
PositionSequence
846-892ERKDGEPQRGPRRGGGAKNYRGGRGRGTFSGPIGGRAVAAGGDRRRG
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027516  EIF3C  
IPR008905  EIF3C_N_dom  
IPR000717  PCI_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0071540  C:eukaryotic translation initiation factor 3 complex, eIF3e  
GO:0071541  C:eukaryotic translation initiation factor 3 complex, eIF3m  
GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
GO:0006413  P:translational initiation  
KEGG pgr:PGTG_09255  -  
Pfam View protein in Pfam  
PF05470  eIF-3c_N  
PF01399  PCI  
PROSITE View protein in PROSITE  
PS50250  PCI  
Amino Acid Sequences MSSFFRTVGSDSESDSSSDEELLSGASGSEAGQADGPKKTTAPLKNRFLKGGSDSDDSDSDDDSSDMDGSDSDDDPKKTTTTGAIKANKFLVGADSDTDSDSEDESRRVVKSAKSKRQDEIDGSVKIMENGAKINDWVVISAEFDKLVRLITRQANAADPLPVSFIKVILSLEESQTAVNENAAVKKKMNATNAKALNTMKQKLKKTIRENEAIIEKYKADPEAFEQEAAAVDAPVPAAKKSKKSKTHDSEEEPDDDDDFTMVGKGGKSFSFSPDSIFKTLQSVLEARGKKNTDRQEQLMILDKLLSISTTTYQRIRILLALISSQFDYNPAITTHLPTEAWKSARVRLDELLNLLSTETQFVVQEETVDYDDQEERAPDSDPTKKLQVRGSISSLLDRLDDEFTKSLQNIDPHTSEYIERLKDEKELYCTIVRAQSYFEAVELTSAVAKAVTRRLEHVYCKPDAVIQPLEAAVPELPSKIFTPTSSPADSASYSSSELIHALCAYLYKTDNSLLQTRAALCQIFNYGLHDEYYRARDLLLMLHLQETVHGADVGTQIMYNRTVVQLGLSAFRLGLIKESQSILQDIFASQRVKELLAQGVQAQRYSQLTPEQDKIERQRQLPYHMHINLELLECAYLVSSMLLEIPNLAQAGNDAELKKRQISRTFRRMFDYAERQVFTGPPENKRDHIMQASKALQTGDWQKCIELINGIKIWALMPRQDALKEMLTRKIQEEALRTYLFTYSSYYSTVSIEYLATSFQLSESEVTSIVSRMIWNEELGGASLDQIDKVVVLSKQELTKLQQLTIGLVDKVSGMAETNERYLESKIGAGADRDGANRAGTGGAERKDGEPQRGPRRGGGAKNYRGGRGRGTFSGPIGGRAVAAGGDRRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.15
5 0.15
6 0.13
7 0.1
8 0.1
9 0.09
10 0.08
11 0.07
12 0.06
13 0.05
14 0.05
15 0.05
16 0.09
17 0.09
18 0.1
19 0.12
20 0.14
21 0.17
22 0.2
23 0.22
24 0.19
25 0.2
26 0.23
27 0.3
28 0.37
29 0.45
30 0.51
31 0.6
32 0.68
33 0.71
34 0.71
35 0.64
36 0.6
37 0.55
38 0.52
39 0.47
40 0.41
41 0.39
42 0.38
43 0.37
44 0.33
45 0.29
46 0.23
47 0.19
48 0.16
49 0.14
50 0.11
51 0.11
52 0.1
53 0.09
54 0.08
55 0.07
56 0.08
57 0.11
58 0.11
59 0.14
60 0.19
61 0.2
62 0.23
63 0.25
64 0.24
65 0.22
66 0.23
67 0.27
68 0.29
69 0.35
70 0.42
71 0.48
72 0.49
73 0.52
74 0.52
75 0.44
76 0.37
77 0.31
78 0.24
79 0.18
80 0.18
81 0.15
82 0.15
83 0.15
84 0.15
85 0.15
86 0.14
87 0.12
88 0.12
89 0.14
90 0.13
91 0.14
92 0.15
93 0.18
94 0.17
95 0.2
96 0.22
97 0.26
98 0.36
99 0.46
100 0.55
101 0.61
102 0.65
103 0.67
104 0.71
105 0.7
106 0.63
107 0.6
108 0.56
109 0.48
110 0.44
111 0.4
112 0.33
113 0.27
114 0.24
115 0.18
116 0.12
117 0.13
118 0.14
119 0.13
120 0.12
121 0.13
122 0.14
123 0.12
124 0.12
125 0.11
126 0.1
127 0.11
128 0.12
129 0.12
130 0.1
131 0.1
132 0.1
133 0.09
134 0.11
135 0.1
136 0.1
137 0.17
138 0.22
139 0.24
140 0.26
141 0.27
142 0.28
143 0.28
144 0.28
145 0.23
146 0.17
147 0.16
148 0.16
149 0.14
150 0.14
151 0.12
152 0.11
153 0.1
154 0.11
155 0.11
156 0.09
157 0.13
158 0.12
159 0.13
160 0.13
161 0.13
162 0.12
163 0.12
164 0.13
165 0.1
166 0.09
167 0.1
168 0.1
169 0.16
170 0.2
171 0.22
172 0.21
173 0.25
174 0.33
175 0.37
176 0.44
177 0.46
178 0.47
179 0.55
180 0.58
181 0.55
182 0.5
183 0.46
184 0.45
185 0.44
186 0.44
187 0.43
188 0.47
189 0.5
190 0.57
191 0.66
192 0.68
193 0.71
194 0.75
195 0.74
196 0.72
197 0.68
198 0.63
199 0.59
200 0.51
201 0.43
202 0.34
203 0.28
204 0.24
205 0.24
206 0.21
207 0.15
208 0.14
209 0.17
210 0.22
211 0.22
212 0.2
213 0.18
214 0.17
215 0.17
216 0.16
217 0.12
218 0.05
219 0.05
220 0.05
221 0.05
222 0.06
223 0.06
224 0.07
225 0.14
226 0.17
227 0.26
228 0.36
229 0.46
230 0.55
231 0.62
232 0.72
233 0.75
234 0.81
235 0.8
236 0.77
237 0.74
238 0.67
239 0.61
240 0.52
241 0.43
242 0.34
243 0.26
244 0.19
245 0.13
246 0.09
247 0.07
248 0.05
249 0.06
250 0.06
251 0.06
252 0.07
253 0.08
254 0.09
255 0.12
256 0.13
257 0.16
258 0.19
259 0.19
260 0.22
261 0.25
262 0.28
263 0.27
264 0.27
265 0.24
266 0.22
267 0.23
268 0.2
269 0.18
270 0.15
271 0.16
272 0.23
273 0.25
274 0.23
275 0.28
276 0.3
277 0.31
278 0.38
279 0.44
280 0.45
281 0.48
282 0.49
283 0.48
284 0.47
285 0.45
286 0.45
287 0.36
288 0.28
289 0.23
290 0.2
291 0.15
292 0.14
293 0.13
294 0.05
295 0.06
296 0.08
297 0.11
298 0.13
299 0.14
300 0.16
301 0.18
302 0.18
303 0.18
304 0.16
305 0.15
306 0.13
307 0.12
308 0.11
309 0.1
310 0.1
311 0.09
312 0.09
313 0.07
314 0.07
315 0.08
316 0.07
317 0.08
318 0.08
319 0.1
320 0.1
321 0.12
322 0.12
323 0.12
324 0.12
325 0.11
326 0.16
327 0.17
328 0.18
329 0.2
330 0.21
331 0.26
332 0.3
333 0.31
334 0.29
335 0.27
336 0.28
337 0.25
338 0.24
339 0.19
340 0.14
341 0.13
342 0.11
343 0.09
344 0.07
345 0.07
346 0.06
347 0.05
348 0.05
349 0.06
350 0.07
351 0.07
352 0.07
353 0.07
354 0.08
355 0.08
356 0.08
357 0.08
358 0.08
359 0.09
360 0.09
361 0.09
362 0.08
363 0.07
364 0.08
365 0.09
366 0.09
367 0.12
368 0.18
369 0.19
370 0.21
371 0.28
372 0.29
373 0.31
374 0.34
375 0.38
376 0.36
377 0.37
378 0.37
379 0.33
380 0.32
381 0.29
382 0.25
383 0.18
384 0.14
385 0.11
386 0.1
387 0.09
388 0.09
389 0.1
390 0.1
391 0.1
392 0.11
393 0.11
394 0.11
395 0.12
396 0.14
397 0.14
398 0.17
399 0.17
400 0.18
401 0.18
402 0.17
403 0.15
404 0.15
405 0.17
406 0.15
407 0.15
408 0.15
409 0.15
410 0.17
411 0.18
412 0.17
413 0.17
414 0.18
415 0.19
416 0.18
417 0.18
418 0.16
419 0.18
420 0.16
421 0.13
422 0.13
423 0.11
424 0.11
425 0.11
426 0.1
427 0.07
428 0.07
429 0.07
430 0.06
431 0.05
432 0.04
433 0.04
434 0.04
435 0.04
436 0.04
437 0.05
438 0.09
439 0.11
440 0.12
441 0.14
442 0.19
443 0.21
444 0.25
445 0.3
446 0.3
447 0.28
448 0.28
449 0.26
450 0.24
451 0.22
452 0.22
453 0.17
454 0.13
455 0.13
456 0.13
457 0.13
458 0.1
459 0.09
460 0.05
461 0.05
462 0.05
463 0.05
464 0.05
465 0.06
466 0.07
467 0.08
468 0.09
469 0.09
470 0.13
471 0.16
472 0.2
473 0.2
474 0.19
475 0.18
476 0.19
477 0.19
478 0.16
479 0.13
480 0.1
481 0.1
482 0.1
483 0.1
484 0.08
485 0.08
486 0.07
487 0.06
488 0.05
489 0.05
490 0.04
491 0.05
492 0.05
493 0.06
494 0.07
495 0.07
496 0.08
497 0.09
498 0.11
499 0.13
500 0.16
501 0.15
502 0.15
503 0.16
504 0.16
505 0.16
506 0.15
507 0.13
508 0.1
509 0.1
510 0.1
511 0.09
512 0.09
513 0.1
514 0.1
515 0.1
516 0.11
517 0.1
518 0.11
519 0.12
520 0.15
521 0.13
522 0.12
523 0.12
524 0.12
525 0.12
526 0.12
527 0.11
528 0.09
529 0.09
530 0.09
531 0.09
532 0.08
533 0.08
534 0.08
535 0.06
536 0.06
537 0.06
538 0.05
539 0.07
540 0.08
541 0.08
542 0.06
543 0.06
544 0.06
545 0.07
546 0.08
547 0.07
548 0.07
549 0.07
550 0.07
551 0.07
552 0.07
553 0.08
554 0.08
555 0.09
556 0.09
557 0.08
558 0.08
559 0.09
560 0.09
561 0.07
562 0.09
563 0.08
564 0.08
565 0.1
566 0.11
567 0.11
568 0.11
569 0.12
570 0.1
571 0.1
572 0.1
573 0.09
574 0.09
575 0.13
576 0.13
577 0.12
578 0.14
579 0.14
580 0.14
581 0.15
582 0.16
583 0.15
584 0.15
585 0.15
586 0.16
587 0.18
588 0.18
589 0.17
590 0.15
591 0.14
592 0.15
593 0.15
594 0.14
595 0.16
596 0.2
597 0.23
598 0.26
599 0.28
600 0.28
601 0.33
602 0.39
603 0.42
604 0.43
605 0.41
606 0.45
607 0.45
608 0.51
609 0.5
610 0.47
611 0.47
612 0.43
613 0.43
614 0.35
615 0.34
616 0.28
617 0.23
618 0.19
619 0.11
620 0.09
621 0.08
622 0.08
623 0.07
624 0.04
625 0.04
626 0.04
627 0.03
628 0.03
629 0.04
630 0.05
631 0.04
632 0.05
633 0.05
634 0.06
635 0.06
636 0.06
637 0.05
638 0.05
639 0.07
640 0.08
641 0.1
642 0.1
643 0.12
644 0.16
645 0.18
646 0.23
647 0.27
648 0.32
649 0.39
650 0.49
651 0.56
652 0.64
653 0.69
654 0.66
655 0.66
656 0.61
657 0.56
658 0.55
659 0.53
660 0.49
661 0.47
662 0.45
663 0.4
664 0.39
665 0.36
666 0.3
667 0.3
668 0.28
669 0.3
670 0.36
671 0.38
672 0.38
673 0.42
674 0.41
675 0.37
676 0.41
677 0.4
678 0.36
679 0.4
680 0.41
681 0.38
682 0.36
683 0.31
684 0.23
685 0.23
686 0.3
687 0.28
688 0.28
689 0.28
690 0.27
691 0.28
692 0.3
693 0.26
694 0.21
695 0.19
696 0.21
697 0.21
698 0.21
699 0.19
700 0.17
701 0.17
702 0.15
703 0.15
704 0.13
705 0.14
706 0.16
707 0.18
708 0.18
709 0.2
710 0.19
711 0.23
712 0.26
713 0.27
714 0.32
715 0.34
716 0.35
717 0.35
718 0.36
719 0.33
720 0.32
721 0.35
722 0.32
723 0.34
724 0.33
725 0.31
726 0.28
727 0.26
728 0.23
729 0.19
730 0.17
731 0.15
732 0.16
733 0.17
734 0.17
735 0.16
736 0.16
737 0.16
738 0.13
739 0.11
740 0.1
741 0.09
742 0.09
743 0.08
744 0.08
745 0.07
746 0.07
747 0.06
748 0.07
749 0.07
750 0.08
751 0.09
752 0.1
753 0.09
754 0.1
755 0.11
756 0.1
757 0.1
758 0.09
759 0.09
760 0.09
761 0.13
762 0.13
763 0.13
764 0.13
765 0.13
766 0.13
767 0.13
768 0.12
769 0.08
770 0.08
771 0.09
772 0.08
773 0.08
774 0.07
775 0.07
776 0.06
777 0.06
778 0.1
779 0.09
780 0.12
781 0.14
782 0.18
783 0.2
784 0.23
785 0.26
786 0.27
787 0.33
788 0.33
789 0.31
790 0.3
791 0.28
792 0.27
793 0.28
794 0.25
795 0.17
796 0.15
797 0.15
798 0.12
799 0.12
800 0.1
801 0.07
802 0.06
803 0.08
804 0.12
805 0.13
806 0.15
807 0.15
808 0.16
809 0.17
810 0.18
811 0.18
812 0.16
813 0.15
814 0.15
815 0.16
816 0.17
817 0.16
818 0.16
819 0.18
820 0.18
821 0.18
822 0.19
823 0.18
824 0.17
825 0.16
826 0.15
827 0.12
828 0.11
829 0.15
830 0.19
831 0.19
832 0.21
833 0.23
834 0.23
835 0.32
836 0.36
837 0.39
838 0.42
839 0.5
840 0.58
841 0.65
842 0.66
843 0.61
844 0.66
845 0.66
846 0.64
847 0.65
848 0.65
849 0.64
850 0.69
851 0.68
852 0.66
853 0.63
854 0.58
855 0.56
856 0.52
857 0.5
858 0.46
859 0.49
860 0.45
861 0.41
862 0.46
863 0.38
864 0.34
865 0.3
866 0.26
867 0.21
868 0.18
869 0.17
870 0.1
871 0.12
872 0.16