Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KDZ2

Protein Details
Accession E3KDZ2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-108LRGGAKKRKKKTYTTPKKIKHKRKKVKMAVLKYYKVBasic
NLS Segment(s)
PositionSequence
73-99LRGGAKKRKKKTYTTPKKIKHKRKKVK
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0031386  F:protein tag  
GO:0003735  F:structural constituent of ribosome  
GO:0031625  F:ubiquitin protein ligase binding  
GO:0019941  P:modification-dependent protein catabolic process  
GO:0016567  P:protein ubiquitination  
GO:0006412  P:translation  
KEGG pgr:PGTG_08310  -  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLEVESADTIDNVKTKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTTPKKIKHKRKKVKMAVLKYYKVESSGTIKRLRRECPAQTCGAGVFMAWHHDRQYCGKCGLTYLFGDKNLAKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.14
5 0.14
6 0.13
7 0.09
8 0.09
9 0.09
10 0.1
11 0.11
12 0.1
13 0.12
14 0.15
15 0.19
16 0.24
17 0.27
18 0.32
19 0.32
20 0.41
21 0.45
22 0.45
23 0.43
24 0.43
25 0.42
26 0.41
27 0.39
28 0.3
29 0.27
30 0.27
31 0.25
32 0.23
33 0.23
34 0.19
35 0.22
36 0.22
37 0.2
38 0.18
39 0.17
40 0.15
41 0.12
42 0.12
43 0.09
44 0.14
45 0.15
46 0.15
47 0.18
48 0.17
49 0.16
50 0.16
51 0.18
52 0.15
53 0.15
54 0.13
55 0.14
56 0.16
57 0.16
58 0.16
59 0.15
60 0.13
61 0.15
62 0.21
63 0.27
64 0.35
65 0.45
66 0.52
67 0.62
68 0.65
69 0.7
70 0.76
71 0.78
72 0.8
73 0.81
74 0.83
75 0.82
76 0.89
77 0.91
78 0.91
79 0.91
80 0.91
81 0.91
82 0.92
83 0.94
84 0.92
85 0.92
86 0.9
87 0.87
88 0.85
89 0.81
90 0.72
91 0.63
92 0.54
93 0.44
94 0.36
95 0.28
96 0.21
97 0.21
98 0.24
99 0.27
100 0.33
101 0.36
102 0.42
103 0.47
104 0.48
105 0.5
106 0.52
107 0.56
108 0.57
109 0.58
110 0.54
111 0.49
112 0.45
113 0.38
114 0.31
115 0.22
116 0.13
117 0.1
118 0.08
119 0.12
120 0.13
121 0.14
122 0.15
123 0.18
124 0.21
125 0.27
126 0.33
127 0.32
128 0.34
129 0.36
130 0.34
131 0.35
132 0.35
133 0.3
134 0.26
135 0.27
136 0.27
137 0.26
138 0.29
139 0.27