Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K9X1

Protein Details
Accession E3K9X1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
108-129TTTKEAAKHPPVSKKKKGKKKKBasic
NLS Segment(s)
PositionSequence
114-129AKHPPVSKKKKGKKKK
Subcellular Location(s) nucl 16, cyto_nucl 13.166, mito_nucl 11.832, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG pgr:PGTG_07415  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVYFRNWDSFVSESNKLYEASPVKTRYCTKWRHELGLLVLKVTDDNKCLKFKTRSAVYLNRFELMTRAMIQQMQNVKTINEPEVASKTSTENKAKVPASTSGSVPISTTTKEAAKHPPVSKKKKGKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.25
4 0.24
5 0.26
6 0.24
7 0.25
8 0.31
9 0.33
10 0.33
11 0.38
12 0.42
13 0.43
14 0.48
15 0.53
16 0.52
17 0.59
18 0.6
19 0.6
20 0.58
21 0.52
22 0.49
23 0.48
24 0.42
25 0.31
26 0.27
27 0.22
28 0.21
29 0.19
30 0.15
31 0.09
32 0.13
33 0.16
34 0.19
35 0.2
36 0.27
37 0.31
38 0.33
39 0.39
40 0.39
41 0.4
42 0.44
43 0.51
44 0.47
45 0.48
46 0.46
47 0.38
48 0.34
49 0.3
50 0.25
51 0.17
52 0.14
53 0.09
54 0.09
55 0.08
56 0.1
57 0.1
58 0.13
59 0.17
60 0.17
61 0.18
62 0.18
63 0.18
64 0.18
65 0.19
66 0.17
67 0.14
68 0.13
69 0.13
70 0.15
71 0.16
72 0.15
73 0.15
74 0.16
75 0.2
76 0.26
77 0.28
78 0.28
79 0.29
80 0.36
81 0.36
82 0.34
83 0.32
84 0.3
85 0.31
86 0.3
87 0.28
88 0.25
89 0.25
90 0.24
91 0.21
92 0.19
93 0.16
94 0.16
95 0.17
96 0.15
97 0.17
98 0.19
99 0.22
100 0.29
101 0.35
102 0.43
103 0.48
104 0.56
105 0.64
106 0.72
107 0.79
108 0.81
109 0.84