Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KH04

Protein Details
Accession E3KH04    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-124RFCRACKVSKPPRAHHCRTCKRCVLKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 4, cyto 1, extr 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001594  Palmitoyltrfase_DHHC  
IPR033682  PFA4  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0005794  C:Golgi apparatus  
GO:0019706  F:protein-cysteine S-palmitoyltransferase activity  
GO:0018230  P:peptidyl-L-cysteine S-palmitoylation  
GO:0006612  P:protein targeting to membrane  
KEGG pgr:PGTG_09292  -  
Pfam View protein in Pfam  
PF01529  DHHC  
PROSITE View protein in PROSITE  
PS50216  DHHC  
Amino Acid Sequences MWSIDTGRLWIIGTTSLISFIAFTPQIFIIIPLFDHPSTNPDCLSLLIPFNILVGLLFINYYLCITTDPGRVPKEWDPIGLIESEEHDRAKILSLGQLRFCRACKVSKPPRAHHCRTCKRCVLKMDHHCPWVNNCVGHHNYGHFLRFLGFVDLACWYHIWMISKRVFGEFAYGPEPSKTEMIILVLNYVSCLPVILAVGVFSLYHLWAVLSNTTTIEGWEKEKARELRRKGRIQQFTYPFSIGIYRNLQVVLGPNPLLWWLPQRMSGDGLRYPTLATIDPLEQYLWPPRDLFTRRAPQLRRRQFEKEAFTYGEERLNPDLIPSGSMRGQSVPQGVPRRTVSPYHADYDVESDESEESDSGRLANGHAVDFSASDEEPLSTLVARRNQASGVPSHQAAVMARRPLVRRGSEGVEIKPVGPHWSPAEFSADPLVDQPTHDDERWLQVEGSEGSDGWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.1
6 0.1
7 0.09
8 0.13
9 0.13
10 0.12
11 0.15
12 0.15
13 0.16
14 0.15
15 0.15
16 0.12
17 0.11
18 0.12
19 0.11
20 0.15
21 0.14
22 0.16
23 0.15
24 0.2
25 0.23
26 0.25
27 0.23
28 0.2
29 0.2
30 0.2
31 0.21
32 0.18
33 0.16
34 0.15
35 0.15
36 0.14
37 0.13
38 0.12
39 0.1
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.06
52 0.09
53 0.13
54 0.18
55 0.21
56 0.27
57 0.29
58 0.3
59 0.35
60 0.38
61 0.42
62 0.39
63 0.36
64 0.33
65 0.31
66 0.31
67 0.25
68 0.2
69 0.12
70 0.14
71 0.15
72 0.14
73 0.14
74 0.13
75 0.13
76 0.13
77 0.15
78 0.14
79 0.12
80 0.16
81 0.22
82 0.25
83 0.29
84 0.31
85 0.32
86 0.33
87 0.33
88 0.33
89 0.3
90 0.35
91 0.36
92 0.45
93 0.53
94 0.59
95 0.66
96 0.68
97 0.77
98 0.8
99 0.81
100 0.8
101 0.81
102 0.83
103 0.82
104 0.83
105 0.81
106 0.78
107 0.76
108 0.75
109 0.73
110 0.72
111 0.75
112 0.75
113 0.71
114 0.69
115 0.64
116 0.57
117 0.51
118 0.47
119 0.39
120 0.32
121 0.28
122 0.3
123 0.3
124 0.3
125 0.28
126 0.23
127 0.24
128 0.24
129 0.24
130 0.17
131 0.16
132 0.15
133 0.15
134 0.14
135 0.13
136 0.11
137 0.1
138 0.1
139 0.11
140 0.1
141 0.1
142 0.09
143 0.07
144 0.07
145 0.09
146 0.12
147 0.13
148 0.19
149 0.22
150 0.23
151 0.24
152 0.23
153 0.23
154 0.19
155 0.22
156 0.16
157 0.15
158 0.15
159 0.15
160 0.14
161 0.14
162 0.15
163 0.11
164 0.11
165 0.09
166 0.08
167 0.08
168 0.09
169 0.09
170 0.08
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.04
178 0.04
179 0.03
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.05
196 0.06
197 0.06
198 0.06
199 0.06
200 0.07
201 0.07
202 0.06
203 0.08
204 0.08
205 0.09
206 0.13
207 0.15
208 0.15
209 0.21
210 0.27
211 0.33
212 0.4
213 0.46
214 0.52
215 0.6
216 0.66
217 0.68
218 0.72
219 0.72
220 0.69
221 0.7
222 0.65
223 0.59
224 0.54
225 0.46
226 0.36
227 0.28
228 0.27
229 0.19
230 0.17
231 0.16
232 0.14
233 0.14
234 0.14
235 0.14
236 0.11
237 0.12
238 0.11
239 0.1
240 0.09
241 0.09
242 0.09
243 0.09
244 0.09
245 0.07
246 0.09
247 0.1
248 0.11
249 0.15
250 0.16
251 0.17
252 0.19
253 0.2
254 0.19
255 0.19
256 0.2
257 0.16
258 0.15
259 0.14
260 0.12
261 0.13
262 0.1
263 0.09
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.08
270 0.1
271 0.16
272 0.16
273 0.16
274 0.16
275 0.16
276 0.24
277 0.27
278 0.3
279 0.32
280 0.39
281 0.43
282 0.51
283 0.56
284 0.58
285 0.66
286 0.71
287 0.69
288 0.67
289 0.7
290 0.7
291 0.72
292 0.69
293 0.61
294 0.55
295 0.49
296 0.45
297 0.4
298 0.33
299 0.29
300 0.22
301 0.21
302 0.19
303 0.19
304 0.17
305 0.15
306 0.16
307 0.13
308 0.14
309 0.12
310 0.13
311 0.13
312 0.14
313 0.14
314 0.13
315 0.14
316 0.15
317 0.18
318 0.17
319 0.23
320 0.3
321 0.3
322 0.33
323 0.35
324 0.35
325 0.34
326 0.36
327 0.34
328 0.34
329 0.36
330 0.34
331 0.33
332 0.3
333 0.28
334 0.28
335 0.25
336 0.17
337 0.14
338 0.12
339 0.11
340 0.11
341 0.11
342 0.08
343 0.07
344 0.07
345 0.08
346 0.07
347 0.07
348 0.07
349 0.07
350 0.11
351 0.11
352 0.11
353 0.11
354 0.11
355 0.1
356 0.1
357 0.11
358 0.09
359 0.08
360 0.08
361 0.09
362 0.09
363 0.09
364 0.09
365 0.09
366 0.07
367 0.1
368 0.15
369 0.21
370 0.22
371 0.24
372 0.25
373 0.25
374 0.27
375 0.27
376 0.25
377 0.24
378 0.25
379 0.24
380 0.23
381 0.23
382 0.22
383 0.2
384 0.23
385 0.23
386 0.23
387 0.25
388 0.29
389 0.31
390 0.36
391 0.42
392 0.39
393 0.39
394 0.41
395 0.43
396 0.46
397 0.47
398 0.42
399 0.4
400 0.38
401 0.34
402 0.31
403 0.27
404 0.26
405 0.23
406 0.25
407 0.23
408 0.25
409 0.26
410 0.25
411 0.32
412 0.26
413 0.26
414 0.28
415 0.24
416 0.21
417 0.21
418 0.24
419 0.17
420 0.17
421 0.2
422 0.21
423 0.26
424 0.26
425 0.28
426 0.26
427 0.34
428 0.35
429 0.34
430 0.27
431 0.23
432 0.27
433 0.25
434 0.26
435 0.18