Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K0J3

Protein Details
Accession E3K0J3   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
145-169ALVQKERTKLKQKKEQQRSNRLENVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0043022  F:ribosome binding  
GO:0003743  F:translation initiation factor activity  
GO:0070124  P:mitochondrial translational initiation  
GO:0032790  P:ribosome disassembly  
KEGG pgr:PGTG_03774  -  
Pfam View protein in Pfam  
PF05198  IF3_N  
Amino Acid Sequences MNPLAPRLALFENACRVIRRTRQDTMHSSSMASRPPIRLKARPVEPQFVGTSAMKFSCEASKQKTKAASDHQIKSEWIQLVNPSSTLKQGSAAPDSDPPSQGANLLVEPALTREVLSRLDLNQYTLIEVNSKTNPPICKIVSREALVQKERTKLKQKKEQQRSNRLENVLKEIQLTWKIERNDLNHKLKAAQQSFEKAYKVRIILNPPSRYQQIDQNHKDELLAIVEEQLTGFGGELVKQESEAGKLIMEWHPVNKQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.31
4 0.36
5 0.43
6 0.48
7 0.49
8 0.54
9 0.59
10 0.64
11 0.68
12 0.67
13 0.63
14 0.54
15 0.48
16 0.45
17 0.41
18 0.37
19 0.34
20 0.3
21 0.31
22 0.37
23 0.45
24 0.47
25 0.51
26 0.55
27 0.6
28 0.64
29 0.68
30 0.66
31 0.64
32 0.58
33 0.55
34 0.48
35 0.4
36 0.36
37 0.27
38 0.22
39 0.17
40 0.17
41 0.14
42 0.13
43 0.14
44 0.16
45 0.2
46 0.24
47 0.3
48 0.39
49 0.4
50 0.45
51 0.49
52 0.46
53 0.48
54 0.51
55 0.54
56 0.52
57 0.55
58 0.53
59 0.48
60 0.46
61 0.42
62 0.39
63 0.31
64 0.23
65 0.19
66 0.19
67 0.2
68 0.2
69 0.19
70 0.15
71 0.13
72 0.15
73 0.15
74 0.13
75 0.12
76 0.13
77 0.15
78 0.16
79 0.16
80 0.16
81 0.18
82 0.22
83 0.21
84 0.2
85 0.18
86 0.17
87 0.16
88 0.15
89 0.13
90 0.1
91 0.09
92 0.08
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.06
101 0.07
102 0.08
103 0.09
104 0.09
105 0.09
106 0.12
107 0.12
108 0.13
109 0.13
110 0.12
111 0.12
112 0.11
113 0.11
114 0.09
115 0.09
116 0.1
117 0.1
118 0.11
119 0.11
120 0.14
121 0.15
122 0.16
123 0.2
124 0.19
125 0.22
126 0.24
127 0.29
128 0.29
129 0.29
130 0.31
131 0.31
132 0.34
133 0.32
134 0.33
135 0.31
136 0.34
137 0.36
138 0.38
139 0.45
140 0.48
141 0.55
142 0.62
143 0.69
144 0.74
145 0.82
146 0.85
147 0.85
148 0.88
149 0.85
150 0.83
151 0.79
152 0.71
153 0.64
154 0.56
155 0.53
156 0.43
157 0.37
158 0.3
159 0.24
160 0.24
161 0.24
162 0.25
163 0.19
164 0.24
165 0.25
166 0.28
167 0.31
168 0.32
169 0.39
170 0.45
171 0.5
172 0.45
173 0.45
174 0.44
175 0.44
176 0.49
177 0.41
178 0.36
179 0.32
180 0.36
181 0.39
182 0.4
183 0.37
184 0.29
185 0.3
186 0.3
187 0.29
188 0.29
189 0.29
190 0.34
191 0.41
192 0.49
193 0.5
194 0.47
195 0.51
196 0.48
197 0.47
198 0.42
199 0.41
200 0.42
201 0.49
202 0.52
203 0.51
204 0.5
205 0.46
206 0.44
207 0.36
208 0.27
209 0.18
210 0.14
211 0.1
212 0.1
213 0.1
214 0.1
215 0.09
216 0.08
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.07
223 0.09
224 0.11
225 0.1
226 0.1
227 0.12
228 0.12
229 0.14
230 0.15
231 0.14
232 0.11
233 0.12
234 0.15
235 0.17
236 0.21
237 0.2
238 0.23