Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JXG0

Protein Details
Accession E3JXG0    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGRRPAKCYRYCKNKPYPKSRYVRSCPDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001197  Ribosomal_L10e  
IPR016180  Ribosomal_L10e/L16  
IPR036920  Ribosomal_L10e/L16_sf  
IPR018255  Ribosomal_L10e_CS  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000027  P:ribosomal large subunit assembly  
GO:0006415  P:translational termination  
KEGG pgr:PGTG_02196  -  
Pfam View protein in Pfam  
PF00252  Ribosomal_L16  
PROSITE View protein in PROSITE  
PS01257  RIBOSOMAL_L10E  
CDD cd01433  Ribosomal_L16_L10e  
Amino Acid Sequences MGRRPAKCYRYCKNKPYPKSRYVRSCPDSKIRIFDLGRKKANVDDFPFCAHLVSNEKEQLSSEALEAARITCNKYVTKTSGKDSFHLRVRAHPFHVVRINKMLSCAGADRLQTGMRGAWGKPYGTVARVNIGQILLSVRCKDSNKAVVMEALRRAQYKFPGQQKIIVSKKWGFTDLSRADYQKLRGEGRIRLDGAYVQFHKAAGPVLTNLSRGAPSLVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.91
4 0.89
5 0.88
6 0.88
7 0.87
8 0.87
9 0.85
10 0.85
11 0.79
12 0.77
13 0.73
14 0.73
15 0.7
16 0.62
17 0.59
18 0.51
19 0.54
20 0.48
21 0.5
22 0.51
23 0.54
24 0.56
25 0.51
26 0.5
27 0.47
28 0.52
29 0.5
30 0.44
31 0.4
32 0.37
33 0.38
34 0.38
35 0.32
36 0.26
37 0.2
38 0.18
39 0.19
40 0.2
41 0.21
42 0.23
43 0.23
44 0.23
45 0.24
46 0.22
47 0.19
48 0.17
49 0.13
50 0.13
51 0.13
52 0.13
53 0.12
54 0.11
55 0.12
56 0.12
57 0.14
58 0.13
59 0.16
60 0.17
61 0.2
62 0.23
63 0.25
64 0.32
65 0.32
66 0.35
67 0.39
68 0.39
69 0.39
70 0.4
71 0.41
72 0.4
73 0.43
74 0.38
75 0.39
76 0.45
77 0.46
78 0.43
79 0.43
80 0.38
81 0.37
82 0.44
83 0.37
84 0.31
85 0.32
86 0.31
87 0.25
88 0.25
89 0.2
90 0.13
91 0.13
92 0.12
93 0.1
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.09
100 0.09
101 0.07
102 0.08
103 0.09
104 0.08
105 0.11
106 0.12
107 0.12
108 0.12
109 0.15
110 0.14
111 0.14
112 0.16
113 0.13
114 0.14
115 0.14
116 0.14
117 0.12
118 0.11
119 0.09
120 0.07
121 0.08
122 0.07
123 0.08
124 0.09
125 0.09
126 0.13
127 0.14
128 0.16
129 0.21
130 0.26
131 0.27
132 0.28
133 0.27
134 0.27
135 0.27
136 0.27
137 0.24
138 0.2
139 0.19
140 0.19
141 0.2
142 0.2
143 0.24
144 0.29
145 0.34
146 0.4
147 0.47
148 0.47
149 0.51
150 0.52
151 0.56
152 0.54
153 0.48
154 0.45
155 0.41
156 0.45
157 0.4
158 0.39
159 0.31
160 0.28
161 0.36
162 0.34
163 0.35
164 0.33
165 0.32
166 0.33
167 0.35
168 0.37
169 0.33
170 0.35
171 0.32
172 0.36
173 0.39
174 0.41
175 0.43
176 0.45
177 0.4
178 0.36
179 0.34
180 0.32
181 0.29
182 0.31
183 0.26
184 0.23
185 0.22
186 0.22
187 0.21
188 0.19
189 0.19
190 0.14
191 0.14
192 0.13
193 0.18
194 0.19
195 0.19
196 0.19
197 0.18
198 0.18
199 0.17
200 0.17