Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KU34

Protein Details
Accession E3KU34    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-36STAPSRSRLLGRRIKKKQSSRLGLGRSGHydrophilic
NLS Segment(s)
PositionSequence
16-29RLLGRRIKKKQSSR
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001509  Epimerase_deHydtase  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0003978  F:UDP-glucose 4-epimerase activity  
GO:0033499  P:galactose catabolic process via UDP-galactose  
KEGG pgr:PGTG_14524  -  
Pfam View protein in Pfam  
PF01370  Epimerase  
Amino Acid Sequences MNKCIKPSSTAPSRSRLLGRRIKKKQSSRLGLGRSGTKQQVVKRAVVVEDWPLILVTGANGYIGSHVVLELLKQGEYGVIAIDSLENSSAESLRRVRELASQEKSLGAHHPPIYHHQTDIRDRRGMLAIFQGYRQRDGRNAIRHVIHFAALKSVEGSRLNPAGYYSTNVLGTAGLLEVMKASGVNSLVFSSSAVVYGSRAGRPGGPGHSSTDLLAESRCPVRAHQPEAERQANYARITNTYGKTKLMCEELIHKLCYEHGQSTNSEENFRAVILRYTNPSGNDPSGRIGDSPTYPENLMPIAAQVLQGTREQISIYGADYPTRDGTGVRDFIHVQDLAKGHLAALSAFQPKGNKFSRGMYPNNCQTYNLGTGKGASVMEVIQALTEASGRPIKTTIAPRRPGDLATVICDPSKAELELGWKAEKGVLEMATDLWKFCVSNPHGLLPLKASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.6
4 0.6
5 0.61
6 0.67
7 0.71
8 0.78
9 0.84
10 0.86
11 0.89
12 0.89
13 0.9
14 0.89
15 0.87
16 0.86
17 0.81
18 0.75
19 0.69
20 0.65
21 0.58
22 0.55
23 0.49
24 0.45
25 0.45
26 0.46
27 0.52
28 0.48
29 0.47
30 0.44
31 0.44
32 0.39
33 0.36
34 0.31
35 0.25
36 0.23
37 0.2
38 0.17
39 0.13
40 0.12
41 0.11
42 0.09
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.05
74 0.06
75 0.07
76 0.08
77 0.08
78 0.12
79 0.15
80 0.17
81 0.19
82 0.19
83 0.2
84 0.25
85 0.31
86 0.36
87 0.37
88 0.36
89 0.35
90 0.36
91 0.35
92 0.29
93 0.26
94 0.21
95 0.22
96 0.23
97 0.25
98 0.25
99 0.32
100 0.38
101 0.35
102 0.34
103 0.33
104 0.37
105 0.45
106 0.51
107 0.49
108 0.44
109 0.44
110 0.45
111 0.44
112 0.38
113 0.29
114 0.26
115 0.24
116 0.22
117 0.24
118 0.26
119 0.23
120 0.27
121 0.28
122 0.24
123 0.25
124 0.31
125 0.37
126 0.4
127 0.42
128 0.42
129 0.43
130 0.42
131 0.41
132 0.35
133 0.29
134 0.22
135 0.19
136 0.18
137 0.15
138 0.15
139 0.13
140 0.12
141 0.13
142 0.13
143 0.13
144 0.14
145 0.15
146 0.15
147 0.14
148 0.14
149 0.14
150 0.13
151 0.14
152 0.12
153 0.12
154 0.12
155 0.12
156 0.11
157 0.09
158 0.08
159 0.06
160 0.05
161 0.04
162 0.04
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.05
171 0.05
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.05
179 0.06
180 0.05
181 0.05
182 0.05
183 0.08
184 0.09
185 0.09
186 0.09
187 0.09
188 0.1
189 0.11
190 0.13
191 0.13
192 0.14
193 0.14
194 0.16
195 0.17
196 0.17
197 0.16
198 0.14
199 0.12
200 0.1
201 0.09
202 0.07
203 0.07
204 0.08
205 0.1
206 0.09
207 0.1
208 0.19
209 0.24
210 0.28
211 0.31
212 0.34
213 0.36
214 0.42
215 0.44
216 0.35
217 0.31
218 0.29
219 0.28
220 0.25
221 0.23
222 0.17
223 0.16
224 0.19
225 0.23
226 0.23
227 0.24
228 0.24
229 0.22
230 0.23
231 0.22
232 0.21
233 0.18
234 0.16
235 0.14
236 0.18
237 0.23
238 0.25
239 0.24
240 0.22
241 0.2
242 0.2
243 0.22
244 0.19
245 0.15
246 0.15
247 0.17
248 0.17
249 0.22
250 0.26
251 0.24
252 0.23
253 0.21
254 0.19
255 0.17
256 0.17
257 0.13
258 0.08
259 0.1
260 0.11
261 0.12
262 0.14
263 0.16
264 0.18
265 0.18
266 0.2
267 0.21
268 0.21
269 0.21
270 0.19
271 0.19
272 0.18
273 0.18
274 0.15
275 0.14
276 0.14
277 0.13
278 0.16
279 0.15
280 0.15
281 0.15
282 0.15
283 0.14
284 0.12
285 0.12
286 0.08
287 0.07
288 0.06
289 0.06
290 0.07
291 0.06
292 0.06
293 0.07
294 0.08
295 0.09
296 0.08
297 0.09
298 0.09
299 0.09
300 0.09
301 0.08
302 0.09
303 0.11
304 0.1
305 0.11
306 0.12
307 0.13
308 0.13
309 0.13
310 0.12
311 0.09
312 0.13
313 0.17
314 0.19
315 0.18
316 0.2
317 0.2
318 0.2
319 0.23
320 0.21
321 0.16
322 0.17
323 0.16
324 0.16
325 0.16
326 0.16
327 0.12
328 0.13
329 0.13
330 0.08
331 0.09
332 0.12
333 0.14
334 0.14
335 0.15
336 0.18
337 0.19
338 0.27
339 0.29
340 0.3
341 0.29
342 0.34
343 0.41
344 0.44
345 0.5
346 0.49
347 0.53
348 0.57
349 0.6
350 0.56
351 0.48
352 0.43
353 0.41
354 0.42
355 0.35
356 0.28
357 0.23
358 0.23
359 0.23
360 0.23
361 0.18
362 0.1
363 0.09
364 0.08
365 0.09
366 0.08
367 0.08
368 0.06
369 0.06
370 0.05
371 0.05
372 0.06
373 0.05
374 0.08
375 0.12
376 0.13
377 0.14
378 0.15
379 0.17
380 0.23
381 0.33
382 0.41
383 0.47
384 0.54
385 0.54
386 0.58
387 0.58
388 0.52
389 0.46
390 0.41
391 0.32
392 0.29
393 0.3
394 0.26
395 0.24
396 0.24
397 0.2
398 0.17
399 0.19
400 0.16
401 0.13
402 0.14
403 0.19
404 0.23
405 0.25
406 0.24
407 0.21
408 0.21
409 0.23
410 0.21
411 0.19
412 0.19
413 0.17
414 0.16
415 0.16
416 0.17
417 0.2
418 0.19
419 0.17
420 0.15
421 0.15
422 0.15
423 0.16
424 0.26
425 0.24
426 0.34
427 0.36
428 0.38
429 0.43
430 0.44
431 0.43