Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KS68

Protein Details
Accession E3KS68    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-124LDLRAKKTRAIRRRLTKHEKNLKTEKQKKRDIHFPKRKYALKABasic
NLS Segment(s)
PositionSequence
75-124KGKKHLPLDLRAKKTRAIRRRLTKHEKNLKTEKQKKRDIHFPKRKYALKA
Subcellular Location(s) nucl 17, mito_nucl 12.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG pgr:PGTG_13362  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
Amino Acid Sequences MTSKVRAHELVTKSKADLTKQLEELKVELVGLRVHKVVGGSSSKLTRINTVRKAIARVLTVIQSKTRENLKQLYKGKKHLPLDLRAKKTRAIRRRLTKHEKNLKTEKQKKRDIHFPKRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.37
4 0.39
5 0.36
6 0.39
7 0.41
8 0.44
9 0.41
10 0.39
11 0.36
12 0.29
13 0.23
14 0.17
15 0.13
16 0.1
17 0.11
18 0.11
19 0.11
20 0.1
21 0.1
22 0.11
23 0.11
24 0.1
25 0.11
26 0.13
27 0.12
28 0.14
29 0.15
30 0.16
31 0.19
32 0.19
33 0.21
34 0.25
35 0.32
36 0.35
37 0.38
38 0.4
39 0.38
40 0.4
41 0.36
42 0.32
43 0.25
44 0.21
45 0.18
46 0.18
47 0.18
48 0.16
49 0.16
50 0.15
51 0.15
52 0.17
53 0.21
54 0.2
55 0.21
56 0.28
57 0.31
58 0.38
59 0.45
60 0.52
61 0.52
62 0.56
63 0.59
64 0.6
65 0.58
66 0.56
67 0.54
68 0.53
69 0.59
70 0.61
71 0.63
72 0.59
73 0.58
74 0.56
75 0.6
76 0.62
77 0.6
78 0.61
79 0.64
80 0.7
81 0.78
82 0.84
83 0.86
84 0.85
85 0.87
86 0.89
87 0.86
88 0.84
89 0.84
90 0.83
91 0.84
92 0.85
93 0.85
94 0.83
95 0.86
96 0.86
97 0.83
98 0.84
99 0.84
100 0.85
101 0.85
102 0.83
103 0.83
104 0.84