Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K698

Protein Details
Accession E3K698    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
110-135LLKAVPKKKVSHSRKRMRSAHKGIQPHydrophilic
NLS Segment(s)
PositionSequence
115-130PKKKVSHSRKRMRSAH
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgr:PGTG_05054  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASIILSTTRNPIRSTGKQQLIPLLNQLRAVTIDDGRLIGLPTTTTDFSSISRVFQSIKQNLCQSLAAISSSILHPHQSSSASSSSSSSAAAAATATTIDPYFFYDFGGLLKAVPKKKVSHSRKRMRSAHKGIQPNLSLGVCPACGEPKRQHFLCLHCYADKVLERSKSIKTPWEKGITP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.55
4 0.57
5 0.58
6 0.59
7 0.62
8 0.56
9 0.49
10 0.48
11 0.42
12 0.36
13 0.34
14 0.32
15 0.24
16 0.22
17 0.23
18 0.18
19 0.14
20 0.14
21 0.13
22 0.13
23 0.12
24 0.12
25 0.1
26 0.07
27 0.07
28 0.06
29 0.07
30 0.1
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.18
37 0.17
38 0.15
39 0.15
40 0.16
41 0.16
42 0.21
43 0.28
44 0.29
45 0.31
46 0.34
47 0.35
48 0.35
49 0.35
50 0.3
51 0.22
52 0.17
53 0.15
54 0.11
55 0.09
56 0.08
57 0.07
58 0.07
59 0.08
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.1
67 0.12
68 0.12
69 0.12
70 0.12
71 0.12
72 0.12
73 0.11
74 0.11
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.06
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.09
96 0.06
97 0.06
98 0.1
99 0.14
100 0.17
101 0.2
102 0.23
103 0.25
104 0.34
105 0.45
106 0.51
107 0.57
108 0.66
109 0.74
110 0.8
111 0.87
112 0.87
113 0.85
114 0.86
115 0.84
116 0.82
117 0.79
118 0.77
119 0.7
120 0.68
121 0.6
122 0.5
123 0.43
124 0.34
125 0.26
126 0.19
127 0.17
128 0.11
129 0.1
130 0.1
131 0.13
132 0.15
133 0.2
134 0.28
135 0.35
136 0.43
137 0.43
138 0.48
139 0.47
140 0.51
141 0.54
142 0.51
143 0.46
144 0.39
145 0.4
146 0.36
147 0.37
148 0.36
149 0.31
150 0.32
151 0.33
152 0.35
153 0.38
154 0.42
155 0.42
156 0.42
157 0.47
158 0.48
159 0.51
160 0.56