Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KUB3

Protein Details
Accession E3KUB3   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-118KGMSQAQKKNAKRKEKRKAENSSKPEAHydrophilic
NLS Segment(s)
PositionSequence
99-111KKNAKRKEKRKAE
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0035145  C:exon-exon junction complex  
GO:0003723  F:RNA binding  
GO:1903259  P:exon-exon junction complex disassembly  
KEGG pgr:PGTG_14603  -  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MPSRPPLLSELTPSTSGIVLDPHTGDRKVAPSKRPDGTLRKEIKIRPGFTPQEDVSKFRSARQSDFEAKKLPKGSVVGLVRPEVAVAQSALKGMSQAQKKNAKRKEKRKAENSSKPEAEEKTPEQWDDAHDDDPRSSTGANPPDHQDTQARPTPHPHPPSRQPQGKPNPGKALFQSALKSSSANPQPPASQHLVPPQPPPASSKKEASSASTPTHKNENHAFKLFTNAVQSLELDDKSNPPPHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.22
4 0.17
5 0.14
6 0.12
7 0.13
8 0.14
9 0.16
10 0.19
11 0.19
12 0.2
13 0.2
14 0.26
15 0.34
16 0.39
17 0.43
18 0.48
19 0.54
20 0.57
21 0.6
22 0.61
23 0.61
24 0.62
25 0.65
26 0.63
27 0.61
28 0.64
29 0.62
30 0.64
31 0.63
32 0.58
33 0.52
34 0.55
35 0.54
36 0.5
37 0.53
38 0.44
39 0.44
40 0.43
41 0.41
42 0.37
43 0.4
44 0.38
45 0.36
46 0.44
47 0.38
48 0.4
49 0.42
50 0.45
51 0.46
52 0.49
53 0.48
54 0.47
55 0.45
56 0.46
57 0.44
58 0.37
59 0.31
60 0.29
61 0.27
62 0.27
63 0.28
64 0.25
65 0.24
66 0.24
67 0.21
68 0.19
69 0.17
70 0.1
71 0.08
72 0.06
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.08
81 0.13
82 0.18
83 0.2
84 0.28
85 0.37
86 0.43
87 0.53
88 0.59
89 0.64
90 0.7
91 0.78
92 0.81
93 0.83
94 0.87
95 0.87
96 0.89
97 0.88
98 0.88
99 0.83
100 0.78
101 0.68
102 0.6
103 0.53
104 0.44
105 0.36
106 0.3
107 0.26
108 0.24
109 0.24
110 0.22
111 0.2
112 0.18
113 0.18
114 0.17
115 0.17
116 0.14
117 0.14
118 0.15
119 0.14
120 0.15
121 0.14
122 0.1
123 0.09
124 0.08
125 0.13
126 0.19
127 0.2
128 0.21
129 0.24
130 0.28
131 0.28
132 0.28
133 0.26
134 0.22
135 0.26
136 0.29
137 0.28
138 0.24
139 0.29
140 0.33
141 0.38
142 0.43
143 0.42
144 0.46
145 0.52
146 0.62
147 0.66
148 0.69
149 0.64
150 0.67
151 0.72
152 0.75
153 0.72
154 0.68
155 0.68
156 0.62
157 0.61
158 0.52
159 0.49
160 0.4
161 0.36
162 0.32
163 0.24
164 0.24
165 0.22
166 0.22
167 0.15
168 0.23
169 0.27
170 0.28
171 0.29
172 0.29
173 0.31
174 0.32
175 0.36
176 0.32
177 0.28
178 0.27
179 0.34
180 0.37
181 0.37
182 0.38
183 0.38
184 0.35
185 0.34
186 0.37
187 0.36
188 0.39
189 0.41
190 0.44
191 0.4
192 0.45
193 0.45
194 0.46
195 0.43
196 0.4
197 0.41
198 0.42
199 0.42
200 0.39
201 0.47
202 0.42
203 0.43
204 0.48
205 0.53
206 0.52
207 0.54
208 0.53
209 0.45
210 0.51
211 0.46
212 0.39
213 0.34
214 0.28
215 0.25
216 0.24
217 0.24
218 0.19
219 0.21
220 0.2
221 0.17
222 0.18
223 0.2
224 0.25