Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KT96

Protein Details
Accession E3KT96    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-44QPGVGKKQSCLRQRFRKEKAANQYQLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 10.333, cyto_mito 8.999, nucl 6.5, mito 5.5
Family & Domain DBs
KEGG pgr:PGTG_13892  -  
Amino Acid Sequences MPREISLRSSDAAMIDHGQPGVGKKQSCLRQRFRKEKAANQYQLSVLEKKETGIKEIIQELKNEFGQDEFETDIIEELEDFHKTLKEPMQDILFELHGGSRMRITPLTTEVRPTAELSGGPLDDIKDVLAEPLVLRWKTLETKFDALQTENLSRYKFCNRHFKLGYSKVLFLLGDLIQNCNMGPPQFLRHIQILKSKALDEAALAYVDPLIDHPWILHDWLTQLSLPLFAFHAAIIFAMVMRDLMGFCVTEHSSPVFLITNWVQYSDLTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.14
5 0.13
6 0.13
7 0.15
8 0.2
9 0.23
10 0.23
11 0.24
12 0.33
13 0.41
14 0.5
15 0.56
16 0.6
17 0.66
18 0.77
19 0.85
20 0.84
21 0.86
22 0.84
23 0.84
24 0.84
25 0.84
26 0.79
27 0.71
28 0.65
29 0.56
30 0.51
31 0.46
32 0.38
33 0.28
34 0.25
35 0.23
36 0.21
37 0.26
38 0.23
39 0.23
40 0.23
41 0.24
42 0.23
43 0.28
44 0.34
45 0.29
46 0.3
47 0.27
48 0.28
49 0.28
50 0.25
51 0.2
52 0.14
53 0.15
54 0.13
55 0.13
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.07
62 0.06
63 0.05
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.1
71 0.13
72 0.17
73 0.19
74 0.2
75 0.22
76 0.23
77 0.21
78 0.22
79 0.19
80 0.15
81 0.12
82 0.1
83 0.08
84 0.1
85 0.1
86 0.1
87 0.09
88 0.1
89 0.12
90 0.12
91 0.13
92 0.11
93 0.15
94 0.19
95 0.18
96 0.2
97 0.19
98 0.19
99 0.19
100 0.18
101 0.15
102 0.11
103 0.11
104 0.1
105 0.1
106 0.08
107 0.08
108 0.07
109 0.07
110 0.06
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.05
120 0.09
121 0.09
122 0.09
123 0.09
124 0.11
125 0.15
126 0.17
127 0.18
128 0.18
129 0.21
130 0.21
131 0.23
132 0.23
133 0.19
134 0.19
135 0.19
136 0.17
137 0.17
138 0.18
139 0.16
140 0.15
141 0.18
142 0.25
143 0.28
144 0.32
145 0.41
146 0.44
147 0.53
148 0.54
149 0.55
150 0.56
151 0.56
152 0.58
153 0.49
154 0.46
155 0.36
156 0.35
157 0.31
158 0.21
159 0.17
160 0.11
161 0.11
162 0.1
163 0.11
164 0.1
165 0.1
166 0.1
167 0.09
168 0.09
169 0.07
170 0.08
171 0.09
172 0.12
173 0.17
174 0.18
175 0.2
176 0.24
177 0.27
178 0.28
179 0.33
180 0.33
181 0.31
182 0.31
183 0.28
184 0.25
185 0.22
186 0.2
187 0.13
188 0.12
189 0.1
190 0.09
191 0.08
192 0.07
193 0.07
194 0.06
195 0.06
196 0.05
197 0.06
198 0.06
199 0.06
200 0.06
201 0.08
202 0.09
203 0.1
204 0.1
205 0.09
206 0.11
207 0.12
208 0.13
209 0.11
210 0.11
211 0.11
212 0.12
213 0.11
214 0.11
215 0.1
216 0.1
217 0.1
218 0.08
219 0.08
220 0.06
221 0.06
222 0.06
223 0.05
224 0.05
225 0.04
226 0.05
227 0.04
228 0.04
229 0.05
230 0.05
231 0.06
232 0.06
233 0.07
234 0.07
235 0.12
236 0.13
237 0.13
238 0.15
239 0.15
240 0.15
241 0.15
242 0.17
243 0.14
244 0.13
245 0.18
246 0.18
247 0.23
248 0.22
249 0.24
250 0.22