Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KIT1

Protein Details
Accession E3KIT1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
99-118APPPKEKIKGSKSTKSKPKKBasic
NLS Segment(s)
PositionSequence
102-118PKEKIKGSKSTKSKPKK
Subcellular Location(s) extr 8, E.R. 4, golg 4, mito 3, plas 3, pero 3
Family & Domain DBs
KEGG pgr:PGTG_10584  -  
Amino Acid Sequences MLSWITSLATSSPDSSALHNHHRPVFNPYLVQISLIMHIKSVTAICCLASYALGMPMESKELAAGSKLGSESKGAKTNKPPDAERCHNCGCVLTEEDTAPPPKEKIKGSKSTKSKPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.21
4 0.23
5 0.31
6 0.34
7 0.38
8 0.43
9 0.44
10 0.44
11 0.46
12 0.46
13 0.38
14 0.35
15 0.31
16 0.29
17 0.27
18 0.26
19 0.18
20 0.13
21 0.14
22 0.15
23 0.14
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.05
38 0.04
39 0.06
40 0.06
41 0.05
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.08
58 0.1
59 0.13
60 0.21
61 0.22
62 0.26
63 0.34
64 0.43
65 0.47
66 0.48
67 0.48
68 0.48
69 0.56
70 0.61
71 0.56
72 0.55
73 0.52
74 0.49
75 0.46
76 0.4
77 0.33
78 0.28
79 0.26
80 0.22
81 0.2
82 0.19
83 0.2
84 0.21
85 0.22
86 0.2
87 0.2
88 0.19
89 0.23
90 0.28
91 0.33
92 0.41
93 0.47
94 0.56
95 0.62
96 0.7
97 0.75
98 0.8