Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H6QS18

Protein Details
Accession H6QS18    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
41-61GGDLKRPRPHHSPRSLEKPPPBasic
137-179DTPRSHKRPRHILRFKVPRRPRARRPKRKKRIRATKAQDRPSTBasic
NLS Segment(s)
PositionSequence
139-172PRSHKRPRHILRFKVPRRPRARRPKRKKRIRATK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
KEGG pgr:PGTG_21615  -  
Amino Acid Sequences MTIFGLRHVLDQYQVSNNAILRRADLEPLYINLKALQHPAGGDLKRPRPHHSPRSLEKPPPIWARPTWLVQRQHAKEPPLNLKEKPTNVPHEPPRRRSARIDAAQKASGDSSRPITPTRIIGKRTTRVPEDNLPKDDTPRSHKRPRHILRFKVPRRPRARRPKRKKRIRATKAQDRPSTQEHSGIPSSDFTCNVEMPVEKAQGQTTPDSTQSECTPPPVTTCGAGNHPDNGKDQALPDKYLSIETPSIKYPGDSNNVDAISTAMSSCPDKTLAVASSPPHDSYSAEITRSPSSKNTVKKILVPHDYLEKSMLTLVAQSGLIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.26
5 0.28
6 0.29
7 0.27
8 0.23
9 0.25
10 0.25
11 0.26
12 0.24
13 0.22
14 0.2
15 0.22
16 0.23
17 0.2
18 0.19
19 0.18
20 0.2
21 0.19
22 0.21
23 0.2
24 0.18
25 0.18
26 0.21
27 0.25
28 0.23
29 0.28
30 0.34
31 0.41
32 0.47
33 0.5
34 0.53
35 0.56
36 0.66
37 0.7
38 0.71
39 0.73
40 0.73
41 0.8
42 0.81
43 0.77
44 0.73
45 0.67
46 0.65
47 0.64
48 0.58
49 0.53
50 0.47
51 0.49
52 0.46
53 0.47
54 0.47
55 0.47
56 0.49
57 0.51
58 0.6
59 0.56
60 0.61
61 0.6
62 0.58
63 0.53
64 0.55
65 0.58
66 0.54
67 0.55
68 0.48
69 0.5
70 0.52
71 0.52
72 0.51
73 0.47
74 0.48
75 0.48
76 0.55
77 0.56
78 0.61
79 0.65
80 0.65
81 0.68
82 0.66
83 0.65
84 0.63
85 0.62
86 0.62
87 0.61
88 0.63
89 0.59
90 0.58
91 0.55
92 0.5
93 0.41
94 0.32
95 0.25
96 0.19
97 0.16
98 0.15
99 0.15
100 0.16
101 0.17
102 0.18
103 0.19
104 0.23
105 0.29
106 0.31
107 0.32
108 0.37
109 0.42
110 0.45
111 0.48
112 0.47
113 0.44
114 0.42
115 0.44
116 0.45
117 0.47
118 0.47
119 0.45
120 0.44
121 0.4
122 0.39
123 0.38
124 0.33
125 0.33
126 0.38
127 0.44
128 0.5
129 0.54
130 0.58
131 0.67
132 0.72
133 0.75
134 0.74
135 0.73
136 0.74
137 0.81
138 0.79
139 0.78
140 0.76
141 0.74
142 0.76
143 0.77
144 0.78
145 0.78
146 0.84
147 0.85
148 0.9
149 0.92
150 0.93
151 0.95
152 0.95
153 0.95
154 0.95
155 0.91
156 0.9
157 0.88
158 0.88
159 0.85
160 0.83
161 0.76
162 0.67
163 0.63
164 0.56
165 0.52
166 0.42
167 0.37
168 0.3
169 0.3
170 0.28
171 0.24
172 0.2
173 0.17
174 0.18
175 0.15
176 0.14
177 0.12
178 0.13
179 0.12
180 0.12
181 0.11
182 0.09
183 0.11
184 0.13
185 0.13
186 0.12
187 0.13
188 0.13
189 0.14
190 0.16
191 0.15
192 0.14
193 0.14
194 0.16
195 0.17
196 0.17
197 0.17
198 0.17
199 0.2
200 0.18
201 0.19
202 0.19
203 0.17
204 0.19
205 0.19
206 0.18
207 0.16
208 0.17
209 0.16
210 0.17
211 0.2
212 0.19
213 0.21
214 0.22
215 0.22
216 0.23
217 0.24
218 0.22
219 0.19
220 0.2
221 0.24
222 0.24
223 0.25
224 0.23
225 0.21
226 0.21
227 0.21
228 0.2
229 0.16
230 0.18
231 0.18
232 0.19
233 0.2
234 0.21
235 0.2
236 0.2
237 0.19
238 0.21
239 0.25
240 0.24
241 0.25
242 0.28
243 0.28
244 0.27
245 0.24
246 0.19
247 0.13
248 0.12
249 0.1
250 0.06
251 0.07
252 0.09
253 0.09
254 0.1
255 0.11
256 0.11
257 0.12
258 0.15
259 0.15
260 0.15
261 0.18
262 0.18
263 0.21
264 0.23
265 0.23
266 0.21
267 0.2
268 0.19
269 0.2
270 0.26
271 0.25
272 0.23
273 0.24
274 0.26
275 0.31
276 0.32
277 0.31
278 0.27
279 0.32
280 0.38
281 0.45
282 0.49
283 0.53
284 0.54
285 0.58
286 0.63
287 0.65
288 0.64
289 0.59
290 0.54
291 0.54
292 0.52
293 0.47
294 0.4
295 0.31
296 0.25
297 0.23
298 0.21
299 0.12
300 0.12
301 0.11
302 0.11