Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L989

Protein Details
Accession E3L989    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSRRQKRRGKRFPGFNRSEHDBasic
NLS Segment(s)
PositionSequence
4-32RRQKRRGKRFPGFNRSEHDEASKSRRRRS
Subcellular Location(s) nucl 21, mito_nucl 13.666, cyto_nucl 12.666, mito 4
Family & Domain DBs
KEGG pgr:PGTG_19219  -  
Amino Acid Sequences MSSRRQKRRGKRFPGFNRSEHDEASKSRRRRSTHVGNAKKFHIWNKCLKNDDTFDMRLRFGIKNPDVHKYEKDSRMQFSDPNSYSSTKPLHPAAYFIVRGTEIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.88
3 0.8
4 0.76
5 0.72
6 0.64
7 0.54
8 0.47
9 0.39
10 0.38
11 0.42
12 0.44
13 0.42
14 0.47
15 0.53
16 0.55
17 0.59
18 0.65
19 0.67
20 0.69
21 0.75
22 0.77
23 0.75
24 0.73
25 0.67
26 0.61
27 0.52
28 0.48
29 0.45
30 0.39
31 0.43
32 0.47
33 0.51
34 0.51
35 0.5
36 0.47
37 0.41
38 0.4
39 0.35
40 0.29
41 0.26
42 0.24
43 0.23
44 0.2
45 0.21
46 0.18
47 0.17
48 0.24
49 0.23
50 0.28
51 0.3
52 0.36
53 0.36
54 0.38
55 0.39
56 0.38
57 0.44
58 0.43
59 0.48
60 0.45
61 0.46
62 0.48
63 0.47
64 0.42
65 0.37
66 0.41
67 0.35
68 0.35
69 0.34
70 0.32
71 0.31
72 0.33
73 0.33
74 0.25
75 0.29
76 0.29
77 0.32
78 0.3
79 0.32
80 0.32
81 0.34
82 0.33
83 0.28
84 0.27