Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KMU9

Protein Details
Accession E3KMU9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AKTRTKKQVTVPRKIRVRREVNHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG pgr:PGTG_11127  -  
Amino Acid Sequences MAKTRTKKQVTVPRKIRVRREVNHIRDSEALERVQGLHTVMAHMDQALATDTRLAEELMAPDGYYEDETNREGNEDAEEDSDSDDGVELLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.81
4 0.8
5 0.81
6 0.75
7 0.76
8 0.77
9 0.75
10 0.75
11 0.66
12 0.58
13 0.5
14 0.48
15 0.4
16 0.32
17 0.25
18 0.18
19 0.17
20 0.15
21 0.14
22 0.11
23 0.09
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.04
32 0.03
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.09
55 0.1
56 0.11
57 0.11
58 0.12
59 0.11
60 0.11
61 0.12
62 0.12
63 0.12
64 0.12
65 0.12
66 0.11
67 0.12
68 0.11
69 0.09
70 0.08
71 0.07