Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3L689

Protein Details
Accession E3L689    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
405-426QELDRKKKSSDRDRGHVQKPSKBasic
NLS Segment(s)
PositionSequence
410-429KKKSSDRDRGHVQKPSKPEP
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0005634  C:nucleus  
GO:1990269  F:RNA polymerase II C-terminal domain phosphoserine binding  
GO:0016570  P:histone modification  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG pgr:PGTG_18154  -  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MSETSNHLTPISAGENQMDGEAKDEETYGNAGQAEPSEQELNDQPLDLEEDLFGGEEDDEGSAGELLPDDDDQADLKRSALEYEEDDDAQPTASRNLYIAEAPLPNLPFPKPSDGKHWDMRIPNFLSFNPLPFSDEEFLNENESSEKEGGESEAAKVLTDQNVIRWRWQKDSEGNPVKRSNARVICWEDGSQSLQVGSELFDMISTVDGRQNNNTTTQQQPGATTQGLTYLFAQHSELKLLEAQASITGQVTLRPYSLNSMTHRNIVANRSLLKANSQRQTSLRVITLDPEKEKIDKELEEERKLKDLKKQDAKLARQNSRQTNLLEGGSRGGVRKRRFNAPLLSDEGEFDQVDEEEEEEEEYEEEMEEDEDENLDDSGRNPRQLSHHEPQLTELELADQKLEEQELDRKKKSSDRDRGHVQKPSKPEPVPSEPKITKRKLIIASDDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.19
5 0.16
6 0.12
7 0.13
8 0.13
9 0.12
10 0.12
11 0.12
12 0.11
13 0.11
14 0.14
15 0.11
16 0.12
17 0.12
18 0.12
19 0.12
20 0.13
21 0.14
22 0.12
23 0.15
24 0.15
25 0.14
26 0.17
27 0.2
28 0.23
29 0.21
30 0.2
31 0.17
32 0.16
33 0.2
34 0.17
35 0.14
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.08
60 0.09
61 0.12
62 0.11
63 0.11
64 0.12
65 0.13
66 0.13
67 0.14
68 0.15
69 0.14
70 0.17
71 0.19
72 0.18
73 0.17
74 0.17
75 0.15
76 0.14
77 0.12
78 0.1
79 0.11
80 0.11
81 0.11
82 0.11
83 0.12
84 0.13
85 0.12
86 0.12
87 0.13
88 0.13
89 0.13
90 0.16
91 0.15
92 0.15
93 0.16
94 0.16
95 0.16
96 0.19
97 0.26
98 0.27
99 0.28
100 0.37
101 0.41
102 0.46
103 0.5
104 0.51
105 0.48
106 0.5
107 0.51
108 0.49
109 0.46
110 0.42
111 0.37
112 0.33
113 0.35
114 0.29
115 0.28
116 0.23
117 0.2
118 0.2
119 0.19
120 0.24
121 0.18
122 0.18
123 0.18
124 0.19
125 0.19
126 0.2
127 0.19
128 0.14
129 0.13
130 0.14
131 0.15
132 0.12
133 0.11
134 0.09
135 0.09
136 0.1
137 0.1
138 0.1
139 0.08
140 0.1
141 0.1
142 0.1
143 0.1
144 0.11
145 0.11
146 0.13
147 0.12
148 0.14
149 0.21
150 0.22
151 0.27
152 0.33
153 0.34
154 0.37
155 0.41
156 0.41
157 0.42
158 0.48
159 0.53
160 0.56
161 0.56
162 0.55
163 0.54
164 0.51
165 0.47
166 0.44
167 0.42
168 0.36
169 0.36
170 0.37
171 0.39
172 0.37
173 0.36
174 0.33
175 0.25
176 0.21
177 0.21
178 0.15
179 0.11
180 0.09
181 0.08
182 0.07
183 0.07
184 0.06
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.05
192 0.04
193 0.05
194 0.08
195 0.1
196 0.11
197 0.13
198 0.15
199 0.16
200 0.19
201 0.2
202 0.2
203 0.21
204 0.22
205 0.21
206 0.19
207 0.2
208 0.17
209 0.18
210 0.15
211 0.13
212 0.11
213 0.12
214 0.12
215 0.11
216 0.1
217 0.1
218 0.1
219 0.1
220 0.12
221 0.1
222 0.1
223 0.11
224 0.1
225 0.09
226 0.09
227 0.09
228 0.09
229 0.07
230 0.07
231 0.06
232 0.06
233 0.06
234 0.05
235 0.05
236 0.05
237 0.07
238 0.08
239 0.08
240 0.08
241 0.09
242 0.09
243 0.12
244 0.14
245 0.16
246 0.17
247 0.23
248 0.24
249 0.26
250 0.26
251 0.24
252 0.25
253 0.23
254 0.24
255 0.19
256 0.19
257 0.19
258 0.2
259 0.19
260 0.22
261 0.27
262 0.31
263 0.34
264 0.34
265 0.34
266 0.35
267 0.41
268 0.37
269 0.33
270 0.27
271 0.24
272 0.23
273 0.24
274 0.27
275 0.24
276 0.22
277 0.22
278 0.22
279 0.21
280 0.22
281 0.21
282 0.2
283 0.18
284 0.21
285 0.29
286 0.32
287 0.37
288 0.39
289 0.37
290 0.41
291 0.43
292 0.41
293 0.39
294 0.43
295 0.47
296 0.55
297 0.57
298 0.58
299 0.65
300 0.68
301 0.7
302 0.7
303 0.67
304 0.65
305 0.7
306 0.68
307 0.63
308 0.61
309 0.53
310 0.47
311 0.42
312 0.35
313 0.29
314 0.22
315 0.19
316 0.16
317 0.16
318 0.14
319 0.18
320 0.24
321 0.27
322 0.36
323 0.39
324 0.48
325 0.51
326 0.55
327 0.58
328 0.55
329 0.54
330 0.5
331 0.48
332 0.39
333 0.35
334 0.3
335 0.24
336 0.19
337 0.15
338 0.11
339 0.09
340 0.09
341 0.09
342 0.08
343 0.07
344 0.08
345 0.08
346 0.07
347 0.08
348 0.07
349 0.07
350 0.07
351 0.06
352 0.06
353 0.06
354 0.06
355 0.06
356 0.07
357 0.07
358 0.07
359 0.07
360 0.07
361 0.07
362 0.07
363 0.07
364 0.07
365 0.17
366 0.2
367 0.23
368 0.23
369 0.27
370 0.33
371 0.41
372 0.49
373 0.46
374 0.52
375 0.52
376 0.52
377 0.52
378 0.48
379 0.42
380 0.33
381 0.25
382 0.21
383 0.19
384 0.19
385 0.17
386 0.13
387 0.12
388 0.13
389 0.14
390 0.1
391 0.12
392 0.2
393 0.29
394 0.38
395 0.41
396 0.42
397 0.46
398 0.53
399 0.6
400 0.63
401 0.64
402 0.65
403 0.7
404 0.78
405 0.83
406 0.83
407 0.82
408 0.77
409 0.72
410 0.72
411 0.72
412 0.7
413 0.63
414 0.63
415 0.63
416 0.67
417 0.69
418 0.64
419 0.66
420 0.63
421 0.7
422 0.72
423 0.7
424 0.67
425 0.65
426 0.69
427 0.67
428 0.68
429 0.66