Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H3J6

Protein Details
Accession Q2H3J6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-42VTEPRTTKLKKTTRRRGTNEKTGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8cyto 8cysk 8cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MDIIAMATGFWVKVPVSRVTEPRTTKLKKTTRRRGTNEKTGSTEGEEQAATGDAPLQKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.22
4 0.25
5 0.3
6 0.33
7 0.41
8 0.41
9 0.43
10 0.47
11 0.45
12 0.47
13 0.52
14 0.57
15 0.59
16 0.67
17 0.73
18 0.75
19 0.81
20 0.84
21 0.85
22 0.84
23 0.84
24 0.79
25 0.71
26 0.65
27 0.57
28 0.5
29 0.43
30 0.38
31 0.28
32 0.23
33 0.2
34 0.16
35 0.15
36 0.14
37 0.1
38 0.07
39 0.1
40 0.11