Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3JTK2

Protein Details
Accession E3JTK2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-93KYLTKKFLKKHQIRNYIRVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG pgr:PGTG_01920  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MTSKTTVTQKFFVDFKKPASDGVFDGPAFEKFLHDRIKVEGRAGQLGDKIKIQSEGVHKLSVSSTIPFSKRYLKYLTKKFLKKHQIRNYIRVIASSKNTYELRYFLVDEPDAEEDDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.4
4 0.39
5 0.38
6 0.37
7 0.35
8 0.29
9 0.3
10 0.28
11 0.21
12 0.22
13 0.2
14 0.18
15 0.17
16 0.15
17 0.13
18 0.12
19 0.18
20 0.22
21 0.22
22 0.22
23 0.25
24 0.32
25 0.3
26 0.31
27 0.28
28 0.24
29 0.25
30 0.24
31 0.2
32 0.17
33 0.18
34 0.17
35 0.16
36 0.14
37 0.13
38 0.14
39 0.13
40 0.14
41 0.16
42 0.21
43 0.21
44 0.21
45 0.2
46 0.2
47 0.19
48 0.17
49 0.14
50 0.09
51 0.09
52 0.12
53 0.13
54 0.14
55 0.16
56 0.24
57 0.24
58 0.27
59 0.33
60 0.39
61 0.47
62 0.54
63 0.62
64 0.62
65 0.67
66 0.69
67 0.72
68 0.74
69 0.74
70 0.76
71 0.77
72 0.79
73 0.78
74 0.8
75 0.77
76 0.72
77 0.63
78 0.54
79 0.47
80 0.4
81 0.39
82 0.35
83 0.29
84 0.29
85 0.3
86 0.29
87 0.29
88 0.26
89 0.25
90 0.24
91 0.26
92 0.22
93 0.26
94 0.24
95 0.23
96 0.24
97 0.23
98 0.21