Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L054

Protein Details
Accession E3L054    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AQGFKSKKTTTTPKNNRHKAQPVKKGGRNIPHydrophilic
NLS Segment(s)
PositionSequence
14-45PKNNRHKAQPVKKGGRNIPPNKPAAVTQKLRK
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG pgr:PGTG_16229  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGFKSKKTTTTPKNNRHKAQPVKKGGRNIPPNKPAAVTQKLRKEKVSKSVTGDIEQMVVSKSVGKLTIMKHLKEAEKTSNSKAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.83
3 0.89
4 0.86
5 0.85
6 0.85
7 0.84
8 0.84
9 0.84
10 0.83
11 0.83
12 0.81
13 0.8
14 0.76
15 0.75
16 0.75
17 0.71
18 0.69
19 0.65
20 0.62
21 0.55
22 0.49
23 0.43
24 0.4
25 0.4
26 0.35
27 0.36
28 0.44
29 0.49
30 0.5
31 0.5
32 0.49
33 0.46
34 0.51
35 0.5
36 0.44
37 0.43
38 0.48
39 0.45
40 0.41
41 0.38
42 0.28
43 0.23
44 0.2
45 0.15
46 0.09
47 0.08
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.13
55 0.15
56 0.25
57 0.28
58 0.28
59 0.31
60 0.36
61 0.4
62 0.41
63 0.44
64 0.43
65 0.46
66 0.5
67 0.51