FuNGI

E3L5C0

Protein Details

Accession

E3L5C0

Localization Confidence

Medium

Confidence Score

13.9

NoLS Segment(s)

Position	Sequence	Protein Nature
349-370	VDPSPAKKAKKVKKGKGAMLGP	Hydrophilic

NLS Segment(s)

Position	Sequence
354-365	AKKAKKVKKGKG

Subcellular Location(s)

nucl 22.5, cyto_nucl 13, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR013893 RNase_P_Rpp40
Gene Ontology	GO:0030681 C:multimeric ribonuclease P complex GO:0000172 C:ribonuclease MRP complex GO:0000447 P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:1905267 P:endonucleolytic cleavage involved in tRNA processing GO:0001682 P:tRNA 5'-leader removal
KEGG	pgr:PGTG_17482 -
Pfam	View protein in Pfam PF08584 Ribonuc_P_40

Amino Acid Sequences

MSHHKKPIKATVPKAHLYISDGYLSSDNSIPIPPKDEPARPPSRQILHHPFTSQINLILSNAEKPEPIDGSEPTRCPEILQHLSDLGKYQHFSNLNLADLLLDEFVQTYFRSGSLVAISLPKFTGDDLFAIDGYGTIHMRLSQSTYQTLGLSGRRSKYGSPGQHFVVEIDMRDRAMRSGKALYERTKRCLDKFPGDVFNDLLGPKHETRGRRWDVVMAWVDEQGSLQPINSSLLSPTTTCKTRVPEINCLEKLVPHITKPDTVESYLDLYEQIGEALLSTSDNHPHPKGGITANSIEAVGFFHPTKLAELTEKVLKIYRIVSITGHTARSAPFSFLTLKQTNRTTHQPVDPSPAKKAKKVKKGKGAMLGPERAVDAGPSSWTFVALEEAEEAPACSSDPSSVPDPSPSALAVLASPQISLDASTDLVVRKRHRPDNDPSSDLTGIPKRPWIIFESVGALDTHC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.68
2	0.59
3	0.5
4	0.45
5	0.38
6	0.3
7	0.26
8	0.23
9	0.23
10	0.22
11	0.21
12	0.2
13	0.17
14	0.16
15	0.14
16	0.17
17	0.18
18	0.19
19	0.24
20	0.22
21	0.28
22	0.33
23	0.38
24	0.42
25	0.48
26	0.56
27	0.53
28	0.59
29	0.61
30	0.61
31	0.6
32	0.64
33	0.65
34	0.6
35	0.61
36	0.56
37	0.5
38	0.46
39	0.44
40	0.35
41	0.27
42	0.24
43	0.21
44	0.2
45	0.19
46	0.17
47	0.17
48	0.17
49	0.15
50	0.14
51	0.14
52	0.17
53	0.16
54	0.18
55	0.17
56	0.18
57	0.23
58	0.28
59	0.28
60	0.27
61	0.28
62	0.26
63	0.24
64	0.27
65	0.29
66	0.31
67	0.31
68	0.31
69	0.31
70	0.32
71	0.31
72	0.28
73	0.22
74	0.18
75	0.18
76	0.17
77	0.22
78	0.23
79	0.24
80	0.29
81	0.28
82	0.26
83	0.25
84	0.24
85	0.17
86	0.16
87	0.14
88	0.07
89	0.06
90	0.05
91	0.05
92	0.05
93	0.06
94	0.06
95	0.07
96	0.07
97	0.07
98	0.08
99	0.08
100	0.09
101	0.09
102	0.1
103	0.09
104	0.13
105	0.13
106	0.13
107	0.13
108	0.12
109	0.11
110	0.11
111	0.12
112	0.09
113	0.09
114	0.09
115	0.1
116	0.09
117	0.09
118	0.09
119	0.07
120	0.06
121	0.07
122	0.06
123	0.06
124	0.06
125	0.07
126	0.08
127	0.09
128	0.13
129	0.14
130	0.16
131	0.17
132	0.18
133	0.18
134	0.17
135	0.18
136	0.16
137	0.16
138	0.18
139	0.21
140	0.22
141	0.23
142	0.24
143	0.24
144	0.3
145	0.36
146	0.4
147	0.4
148	0.42
149	0.41
150	0.41
151	0.4
152	0.32
153	0.27
154	0.19
155	0.14
156	0.12
157	0.11
158	0.1
159	0.1
160	0.11
161	0.09
162	0.13
163	0.13
164	0.14
165	0.17
166	0.19
167	0.24
168	0.28
169	0.33
170	0.39
171	0.41
172	0.43
173	0.48
174	0.49
175	0.46
176	0.51
177	0.5
178	0.47
179	0.49
180	0.48
181	0.47
182	0.45
183	0.42
184	0.33
185	0.28
186	0.23
187	0.17
188	0.14
189	0.09
190	0.12
191	0.11
192	0.15
193	0.18
194	0.2
195	0.25
196	0.35
197	0.37
198	0.36
199	0.36
200	0.35
201	0.32
202	0.34
203	0.31
204	0.22
205	0.18
206	0.16
207	0.16
208	0.12
209	0.12
210	0.07
211	0.06
212	0.05
213	0.05
214	0.04
215	0.05
216	0.06
217	0.06
218	0.06
219	0.06
220	0.07
221	0.07
222	0.08
223	0.09
224	0.11
225	0.12
226	0.14
227	0.17
228	0.19
229	0.23
230	0.3
231	0.33
232	0.39
233	0.41
234	0.47
235	0.44
236	0.42
237	0.37
238	0.31
239	0.29
240	0.25
241	0.21
242	0.15
243	0.18
244	0.18
245	0.21
246	0.22
247	0.22
248	0.19
249	0.19
250	0.19
251	0.16
252	0.16
253	0.14
254	0.12
255	0.09
256	0.08
257	0.07
258	0.06
259	0.05
260	0.03
261	0.03
262	0.03
263	0.03
264	0.03
265	0.03
266	0.04
267	0.06
268	0.09
269	0.11
270	0.14
271	0.14
272	0.15
273	0.15
274	0.16
275	0.18
276	0.17
277	0.18
278	0.18
279	0.18
280	0.18
281	0.18
282	0.16
283	0.13
284	0.11
285	0.09
286	0.07
287	0.08
288	0.07
289	0.07
290	0.08
291	0.08
292	0.1
293	0.1
294	0.11
295	0.11
296	0.12
297	0.15
298	0.18
299	0.18
300	0.17
301	0.18
302	0.18
303	0.17
304	0.17
305	0.18
306	0.15
307	0.16
308	0.16
309	0.15
310	0.19
311	0.2
312	0.19
313	0.16
314	0.16
315	0.15
316	0.19
317	0.19
318	0.15
319	0.14
320	0.15
321	0.18
322	0.19
323	0.26
324	0.27
325	0.28
326	0.32
327	0.37
328	0.38
329	0.4
330	0.45
331	0.44
332	0.45
333	0.48
334	0.47
335	0.44
336	0.49
337	0.51
338	0.46
339	0.48
340	0.52
341	0.49
342	0.52
343	0.6
344	0.61
345	0.65
346	0.73
347	0.75
348	0.77
349	0.83
350	0.82
351	0.81
352	0.76
353	0.73
354	0.69
355	0.61
356	0.51
357	0.43
358	0.36
359	0.27
360	0.23
361	0.15
362	0.1
363	0.08
364	0.1
365	0.1
366	0.11
367	0.11
368	0.11
369	0.11
370	0.1
371	0.12
372	0.11
373	0.11
374	0.11
375	0.11
376	0.11
377	0.1
378	0.1
379	0.08
380	0.08
381	0.08
382	0.06
383	0.07
384	0.08
385	0.1
386	0.14
387	0.17
388	0.19
389	0.19
390	0.21
391	0.23
392	0.22
393	0.22
394	0.17
395	0.15
396	0.13
397	0.12
398	0.1
399	0.09
400	0.11
401	0.09
402	0.09
403	0.08
404	0.09
405	0.09
406	0.09
407	0.09
408	0.08
409	0.08
410	0.09
411	0.11
412	0.13
413	0.17
414	0.24
415	0.27
416	0.35
417	0.44
418	0.53
419	0.59
420	0.64
421	0.7
422	0.74
423	0.77
424	0.71
425	0.64
426	0.61
427	0.54
428	0.47
429	0.43
430	0.39
431	0.35
432	0.34
433	0.37
434	0.34
435	0.34
436	0.36
437	0.35
438	0.34
439	0.32
440	0.32
441	0.31
442	0.28
443	0.28

E3L5C0

3D AlphaFold-predicted Structure Viewer