Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KX39

Protein Details
Accession E3KX39    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-62AGPLEDEERRPRKKRSKARVGASSQDDHydrophilic
NLS Segment(s)
PositionSequence
44-54RRPRKKRSKAR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0032993  C:protein-DNA complex  
GO:0032131  F:alkylated DNA binding  
GO:0008725  F:DNA-3-methyladenine glycosylase activity  
GO:0043916  F:DNA-7-methylguanine glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
GO:0006307  P:DNA dealkylation involved in DNA repair  
KEGG pgr:PGTG_14148  -  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MTAVSRVTRSTTRKAIAEAQTKLSASSAKLTSKQTAGPLEDEERRPRKKRSKARVGASSQDDGQSLKTASQDPTRPFVLSEAQAHLAALDDRFSLLFGRLPCGPFDNLSKSSIDQVAEPFRNLCCSILGQQVSCLAARSITYKFIKLFQPELPPKLEPNTRPSEFQFPSPSDVLHTPVLTLRTAGLSQRKAEYIHDLAQRFVDRRLDPQALLTMEPRMVVNELCKVRGIGRWTAEMFLIFCVKHPDILPHADLAIQKGILRWYTTALLPLKAEEGRGSKKEAEEGNAGLSTPPIPVGCPLSRQELSRRLTKPLKPGLFLTPLEMEQLTEQWKPYRSLPVCYMWSLTGFIPEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.56
4 0.58
5 0.53
6 0.5
7 0.49
8 0.47
9 0.43
10 0.35
11 0.29
12 0.22
13 0.25
14 0.24
15 0.25
16 0.3
17 0.34
18 0.36
19 0.36
20 0.38
21 0.37
22 0.38
23 0.36
24 0.33
25 0.33
26 0.34
27 0.38
28 0.4
29 0.44
30 0.48
31 0.55
32 0.59
33 0.66
34 0.71
35 0.76
36 0.83
37 0.84
38 0.87
39 0.87
40 0.9
41 0.89
42 0.84
43 0.8
44 0.74
45 0.65
46 0.54
47 0.46
48 0.37
49 0.28
50 0.24
51 0.19
52 0.15
53 0.13
54 0.15
55 0.17
56 0.19
57 0.25
58 0.3
59 0.31
60 0.34
61 0.35
62 0.33
63 0.3
64 0.29
65 0.27
66 0.24
67 0.23
68 0.22
69 0.22
70 0.21
71 0.2
72 0.18
73 0.14
74 0.12
75 0.1
76 0.08
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.07
83 0.1
84 0.1
85 0.12
86 0.14
87 0.15
88 0.16
89 0.18
90 0.18
91 0.16
92 0.2
93 0.24
94 0.23
95 0.24
96 0.24
97 0.22
98 0.23
99 0.24
100 0.2
101 0.15
102 0.16
103 0.21
104 0.21
105 0.21
106 0.2
107 0.18
108 0.2
109 0.19
110 0.17
111 0.11
112 0.12
113 0.14
114 0.19
115 0.19
116 0.17
117 0.17
118 0.17
119 0.17
120 0.15
121 0.13
122 0.07
123 0.07
124 0.07
125 0.1
126 0.09
127 0.15
128 0.16
129 0.17
130 0.18
131 0.21
132 0.25
133 0.25
134 0.27
135 0.24
136 0.32
137 0.33
138 0.35
139 0.34
140 0.31
141 0.29
142 0.31
143 0.32
144 0.25
145 0.28
146 0.33
147 0.32
148 0.33
149 0.34
150 0.38
151 0.35
152 0.35
153 0.33
154 0.26
155 0.29
156 0.27
157 0.25
158 0.18
159 0.18
160 0.18
161 0.15
162 0.13
163 0.1
164 0.11
165 0.12
166 0.1
167 0.1
168 0.07
169 0.07
170 0.08
171 0.1
172 0.14
173 0.14
174 0.16
175 0.17
176 0.17
177 0.17
178 0.18
179 0.2
180 0.18
181 0.22
182 0.25
183 0.25
184 0.24
185 0.25
186 0.25
187 0.22
188 0.21
189 0.21
190 0.17
191 0.19
192 0.24
193 0.24
194 0.23
195 0.22
196 0.24
197 0.19
198 0.19
199 0.17
200 0.12
201 0.11
202 0.11
203 0.1
204 0.08
205 0.08
206 0.08
207 0.08
208 0.14
209 0.15
210 0.15
211 0.15
212 0.15
213 0.16
214 0.19
215 0.21
216 0.19
217 0.2
218 0.22
219 0.23
220 0.23
221 0.21
222 0.18
223 0.15
224 0.12
225 0.12
226 0.09
227 0.09
228 0.14
229 0.14
230 0.16
231 0.16
232 0.18
233 0.2
234 0.23
235 0.23
236 0.17
237 0.17
238 0.18
239 0.18
240 0.16
241 0.14
242 0.11
243 0.11
244 0.12
245 0.13
246 0.12
247 0.13
248 0.12
249 0.13
250 0.15
251 0.15
252 0.19
253 0.19
254 0.19
255 0.18
256 0.18
257 0.19
258 0.17
259 0.18
260 0.15
261 0.19
262 0.23
263 0.25
264 0.28
265 0.28
266 0.29
267 0.34
268 0.33
269 0.31
270 0.28
271 0.27
272 0.25
273 0.22
274 0.22
275 0.16
276 0.15
277 0.11
278 0.08
279 0.09
280 0.07
281 0.07
282 0.09
283 0.15
284 0.16
285 0.2
286 0.22
287 0.28
288 0.3
289 0.32
290 0.38
291 0.41
292 0.43
293 0.48
294 0.48
295 0.49
296 0.56
297 0.59
298 0.61
299 0.63
300 0.63
301 0.57
302 0.58
303 0.55
304 0.53
305 0.47
306 0.41
307 0.34
308 0.29
309 0.29
310 0.26
311 0.2
312 0.15
313 0.18
314 0.18
315 0.17
316 0.19
317 0.23
318 0.26
319 0.29
320 0.32
321 0.4
322 0.39
323 0.44
324 0.46
325 0.48
326 0.48
327 0.46
328 0.45
329 0.35
330 0.33
331 0.29
332 0.24