Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KV30

Protein Details
Accession E3KV30    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
85-110DKLVDGKKKKKFKLGRPPKATNFNKSBasic
NLS Segment(s)
PositionSequence
65-73KKHKRGHEK
89-103DGKKKKKFKLGRPPK
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 4
Family & Domain DBs
KEGG pgr:PGTG_12577  -  
Amino Acid Sequences MVFPELPIPRKVCTGTTTGSEKTVHYGWNGGPVHEENWKAALKGIPISYGANPITDIGTTLGIAKKHKRGHEKVINNGRPPDTTDKLVDGKKKKKFKLGRPPKATNFNKSLWSAYPSYQTNKDNTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.29
4 0.32
5 0.29
6 0.29
7 0.28
8 0.25
9 0.26
10 0.25
11 0.21
12 0.17
13 0.19
14 0.16
15 0.24
16 0.24
17 0.2
18 0.21
19 0.21
20 0.22
21 0.23
22 0.23
23 0.15
24 0.18
25 0.18
26 0.16
27 0.16
28 0.16
29 0.14
30 0.16
31 0.15
32 0.12
33 0.13
34 0.14
35 0.13
36 0.15
37 0.14
38 0.11
39 0.11
40 0.11
41 0.1
42 0.08
43 0.08
44 0.06
45 0.06
46 0.05
47 0.06
48 0.08
49 0.09
50 0.11
51 0.14
52 0.21
53 0.26
54 0.32
55 0.4
56 0.43
57 0.52
58 0.6
59 0.62
60 0.64
61 0.7
62 0.69
63 0.62
64 0.6
65 0.51
66 0.42
67 0.41
68 0.38
69 0.3
70 0.28
71 0.27
72 0.27
73 0.3
74 0.33
75 0.37
76 0.4
77 0.46
78 0.52
79 0.61
80 0.62
81 0.68
82 0.74
83 0.77
84 0.79
85 0.82
86 0.84
87 0.84
88 0.88
89 0.85
90 0.87
91 0.81
92 0.77
93 0.71
94 0.62
95 0.58
96 0.51
97 0.47
98 0.38
99 0.38
100 0.32
101 0.29
102 0.34
103 0.33
104 0.36
105 0.4
106 0.41