Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K6S2

Protein Details
Accession E3K6S2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-40GRDFSHHRRPPPKPVAKPRPTLPBasic
NLS Segment(s)
PositionSequence
25-35RRPPPKPVAKP
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, mito 7, cyto 5.5
Family & Domain DBs
KEGG pgr:PGTG_05147  -  
Amino Acid Sequences MRTVHESDYPICPIGAPGRDFSHHRRPPPKPVAKPRPTLPSSGSARPQGMVFSIDDLPQDLKNIGGTGLPSVANRLSAPLSPQARASRAKGVIFNVDELPQDLKELAAAHATKAKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.21
4 0.22
5 0.24
6 0.27
7 0.31
8 0.37
9 0.43
10 0.44
11 0.51
12 0.58
13 0.61
14 0.68
15 0.75
16 0.78
17 0.77
18 0.82
19 0.85
20 0.82
21 0.82
22 0.76
23 0.75
24 0.66
25 0.59
26 0.5
27 0.47
28 0.44
29 0.42
30 0.4
31 0.33
32 0.32
33 0.3
34 0.27
35 0.19
36 0.15
37 0.12
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.09
65 0.11
66 0.16
67 0.18
68 0.18
69 0.22
70 0.23
71 0.26
72 0.29
73 0.3
74 0.31
75 0.33
76 0.34
77 0.32
78 0.32
79 0.34
80 0.31
81 0.3
82 0.24
83 0.22
84 0.2
85 0.19
86 0.19
87 0.14
88 0.14
89 0.12
90 0.1
91 0.11
92 0.12
93 0.11
94 0.14
95 0.14
96 0.15
97 0.22