Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K774

Protein Details
Accession E3K774    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
370-395NLNMQRSIVKRIQKKKQRIQQQQSKNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, mito 6, nucl 5, cyto 3, pero 2, plas 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR027533  3_ketoreductase_fungal  
IPR036291  NAD(P)-bd_dom_sf  
IPR020904  Sc_DH/Rdtase_CS  
IPR002347  SDR_fam  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0102339  F:3-oxo-arachidoyl-CoA reductase activity  
GO:0102340  F:3-oxo-behenoyl-CoA reductase activity  
GO:0102342  F:3-oxo-cerotoyl-CoA reductase activity  
GO:0102341  F:3-oxo-lignoceroyl-CoA reductase activity  
GO:0045703  F:ketoreductase activity  
GO:0030497  P:fatty acid elongation  
KEGG pgr:PGTG_05352  -  
Pfam View protein in Pfam  
PF00106  adh_short  
PROSITE View protein in PROSITE  
PS00061  ADH_SHORT  
CDD cd05356  17beta-HSD1_like_SDR_c  
Amino Acid Sequences MSFHGLVNLVKSVQAELMNVKATPGSILIGSLSLIGLLTVAKYQLSFMNLLFCFSPLSKPFKISLGSLKGNLFLKQKDRQGGEKDQKTPATKNSSSWAIITGPTNGIGKEFAIELSKAGFNLFLIGRNPNKLTSLQDELMKVNPTIEVEIETIDLSDNNPGGRGEEKDSGSVAVQEQTQSKEWKKILEKLKQISSRSNISILINNAGLSHSEPIEFQMNDLDQDINSLLNVNVFSVLYLTKLVLPFMLPYKKGLILNVGSFSALIPTPLLSTYAGSKGFLYTWSQALGTELEPRGIDVKLLNTYFVASEMSKIKKASFLIPTPNAYVKQVLNNLISTNSKPFITTGYFSHSLLEFFLDHFGSLKFWLKFNLNMQRSIVKRIQKKKQRIQQQQSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.18
5 0.18
6 0.17
7 0.17
8 0.14
9 0.13
10 0.13
11 0.11
12 0.1
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.06
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.1
32 0.12
33 0.13
34 0.13
35 0.2
36 0.2
37 0.21
38 0.2
39 0.18
40 0.18
41 0.18
42 0.24
43 0.2
44 0.28
45 0.28
46 0.31
47 0.32
48 0.34
49 0.35
50 0.31
51 0.35
52 0.35
53 0.36
54 0.36
55 0.35
56 0.35
57 0.35
58 0.36
59 0.32
60 0.29
61 0.33
62 0.37
63 0.43
64 0.46
65 0.48
66 0.51
67 0.53
68 0.6
69 0.63
70 0.64
71 0.62
72 0.6
73 0.62
74 0.6
75 0.56
76 0.53
77 0.52
78 0.47
79 0.44
80 0.44
81 0.42
82 0.38
83 0.35
84 0.29
85 0.21
86 0.21
87 0.2
88 0.17
89 0.13
90 0.14
91 0.14
92 0.12
93 0.11
94 0.1
95 0.09
96 0.08
97 0.08
98 0.07
99 0.08
100 0.08
101 0.08
102 0.1
103 0.1
104 0.09
105 0.09
106 0.08
107 0.07
108 0.09
109 0.1
110 0.1
111 0.11
112 0.15
113 0.17
114 0.2
115 0.21
116 0.19
117 0.21
118 0.2
119 0.22
120 0.22
121 0.25
122 0.24
123 0.25
124 0.25
125 0.24
126 0.25
127 0.23
128 0.19
129 0.14
130 0.13
131 0.11
132 0.1
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.06
141 0.06
142 0.05
143 0.06
144 0.06
145 0.06
146 0.07
147 0.06
148 0.07
149 0.09
150 0.1
151 0.13
152 0.17
153 0.17
154 0.17
155 0.18
156 0.17
157 0.16
158 0.14
159 0.11
160 0.08
161 0.08
162 0.09
163 0.1
164 0.11
165 0.14
166 0.18
167 0.19
168 0.24
169 0.25
170 0.3
171 0.32
172 0.38
173 0.44
174 0.47
175 0.52
176 0.5
177 0.57
178 0.55
179 0.53
180 0.5
181 0.45
182 0.4
183 0.35
184 0.31
185 0.25
186 0.21
187 0.22
188 0.18
189 0.16
190 0.12
191 0.11
192 0.1
193 0.09
194 0.09
195 0.07
196 0.07
197 0.06
198 0.06
199 0.06
200 0.07
201 0.11
202 0.1
203 0.1
204 0.11
205 0.11
206 0.11
207 0.12
208 0.1
209 0.06
210 0.07
211 0.07
212 0.05
213 0.05
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.08
233 0.13
234 0.16
235 0.14
236 0.15
237 0.18
238 0.21
239 0.21
240 0.2
241 0.19
242 0.18
243 0.18
244 0.18
245 0.16
246 0.13
247 0.12
248 0.12
249 0.09
250 0.07
251 0.06
252 0.05
253 0.05
254 0.06
255 0.06
256 0.07
257 0.06
258 0.07
259 0.09
260 0.12
261 0.12
262 0.12
263 0.12
264 0.12
265 0.12
266 0.12
267 0.14
268 0.12
269 0.13
270 0.13
271 0.13
272 0.12
273 0.13
274 0.13
275 0.11
276 0.14
277 0.13
278 0.14
279 0.13
280 0.14
281 0.15
282 0.13
283 0.13
284 0.09
285 0.12
286 0.15
287 0.16
288 0.16
289 0.14
290 0.14
291 0.14
292 0.13
293 0.12
294 0.08
295 0.11
296 0.16
297 0.19
298 0.22
299 0.22
300 0.22
301 0.25
302 0.27
303 0.3
304 0.31
305 0.33
306 0.38
307 0.41
308 0.42
309 0.41
310 0.43
311 0.38
312 0.33
313 0.32
314 0.25
315 0.28
316 0.3
317 0.3
318 0.28
319 0.28
320 0.27
321 0.26
322 0.27
323 0.23
324 0.23
325 0.21
326 0.2
327 0.19
328 0.19
329 0.21
330 0.22
331 0.22
332 0.2
333 0.26
334 0.27
335 0.27
336 0.29
337 0.25
338 0.21
339 0.2
340 0.2
341 0.12
342 0.11
343 0.14
344 0.12
345 0.11
346 0.12
347 0.12
348 0.11
349 0.14
350 0.2
351 0.19
352 0.2
353 0.25
354 0.27
355 0.32
356 0.4
357 0.48
358 0.43
359 0.45
360 0.47
361 0.5
362 0.49
363 0.51
364 0.49
365 0.47
366 0.54
367 0.61
368 0.69
369 0.72
370 0.81
371 0.85
372 0.88
373 0.9
374 0.92
375 0.93