Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3L4I3

Protein Details
Accession E3L4I3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-92TENPTPMVSKKPKKRKRKEAAFVLIKFFHydrophilic
NLS Segment(s)
PositionSequence
74-82KKPKKRKRK
Subcellular Location(s) nucl 21, cyto_nucl 15.5, cyto 6
Family & Domain DBs
KEGG pgr:PGTG_17708  -  
Amino Acid Sequences MQPLTPSNDSQPDLEECDAASSELTSLSSLDEDLTSIDEITEKTTKTQSNRSSSLSSLSCRNTDTENPTPMVSKKPKKRKRKEAAFVLIKFFLIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.17
4 0.17
5 0.16
6 0.13
7 0.11
8 0.07
9 0.06
10 0.07
11 0.07
12 0.06
13 0.05
14 0.05
15 0.06
16 0.05
17 0.06
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.08
28 0.1
29 0.09
30 0.1
31 0.14
32 0.17
33 0.2
34 0.28
35 0.32
36 0.36
37 0.39
38 0.41
39 0.39
40 0.36
41 0.37
42 0.3
43 0.25
44 0.24
45 0.23
46 0.21
47 0.2
48 0.21
49 0.2
50 0.22
51 0.29
52 0.3
53 0.3
54 0.31
55 0.3
56 0.32
57 0.3
58 0.35
59 0.37
60 0.42
61 0.5
62 0.6
63 0.69
64 0.78
65 0.88
66 0.91
67 0.92
68 0.94
69 0.93
70 0.93
71 0.93
72 0.91
73 0.82
74 0.75
75 0.65