Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KAU9

Protein Details
Accession E3KAU9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-78PSTKNSHEKRGLEKRKKKKGGGRGGGAKKKKABasic
NLS Segment(s)
PositionSequence
54-78EKRGLEKRKKKKGGGRGGGAKKKKA
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
KEGG pgr:PGTG_06819  -  
Amino Acid Sequences MQLLQLSIFTLAAVLMASLHAEGVTSEIGSAERKLIQAEESIGSTAPSTKNSHEKRGLEKRKKKKGGGRGGGAKKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.06
17 0.07
18 0.06
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.09
26 0.08
27 0.08
28 0.08
29 0.07
30 0.07
31 0.06
32 0.08
33 0.07
34 0.1
35 0.12
36 0.15
37 0.25
38 0.28
39 0.36
40 0.42
41 0.44
42 0.52
43 0.61
44 0.69
45 0.7
46 0.77
47 0.8
48 0.84
49 0.9
50 0.89
51 0.87
52 0.87
53 0.87
54 0.86
55 0.84
56 0.83
57 0.84
58 0.85