Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JWM6

Protein Details
Accession E3JWM6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-31NPGQVSPKEKLRNERWYRRRLKAIQDSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8, mito 6.5, cyto_mito 5, plas 3, E.R. 3, cyto 2.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR011016  Znf_RING-CH  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
GO:0008270  F:zinc ion binding  
KEGG pgr:PGTG_02892  -  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MTKNPGQVSPKEKLRNERWYRRRLKAIQDSTIKPFTRSIERIKGLLSKKVRLKSDLDSCRICFEEYKYDEPGTLLLVFPGCGEVFHESCLTRWLDESPCIESVFRHTLACPTCRRQAPTKHGLRFFGALTSYHRNGILLINLHIALFLLVLFLMREAIIRNSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.77
4 0.8
5 0.81
6 0.82
7 0.86
8 0.85
9 0.86
10 0.81
11 0.82
12 0.81
13 0.79
14 0.76
15 0.74
16 0.69
17 0.65
18 0.66
19 0.55
20 0.46
21 0.42
22 0.37
23 0.39
24 0.39
25 0.41
26 0.42
27 0.43
28 0.42
29 0.41
30 0.45
31 0.39
32 0.43
33 0.39
34 0.37
35 0.42
36 0.48
37 0.48
38 0.44
39 0.45
40 0.44
41 0.51
42 0.49
43 0.47
44 0.43
45 0.42
46 0.41
47 0.38
48 0.32
49 0.23
50 0.2
51 0.24
52 0.25
53 0.27
54 0.27
55 0.26
56 0.25
57 0.24
58 0.21
59 0.14
60 0.11
61 0.08
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.07
71 0.07
72 0.08
73 0.09
74 0.09
75 0.09
76 0.12
77 0.11
78 0.09
79 0.1
80 0.11
81 0.12
82 0.14
83 0.15
84 0.15
85 0.16
86 0.16
87 0.15
88 0.13
89 0.17
90 0.18
91 0.18
92 0.16
93 0.15
94 0.2
95 0.23
96 0.27
97 0.26
98 0.27
99 0.34
100 0.38
101 0.42
102 0.45
103 0.52
104 0.56
105 0.61
106 0.66
107 0.66
108 0.65
109 0.63
110 0.57
111 0.49
112 0.41
113 0.33
114 0.24
115 0.18
116 0.21
117 0.25
118 0.24
119 0.23
120 0.23
121 0.21
122 0.21
123 0.22
124 0.2
125 0.15
126 0.15
127 0.16
128 0.16
129 0.15
130 0.14
131 0.12
132 0.08
133 0.06
134 0.05
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.07
144 0.11