Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KJT5

Protein Details
Accession E3KJT5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-99CTESKCSKYKRHFDHCQERVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003422  Cyt_b-c1_6  
IPR023184  Ubol_cytC_Rdtase_hinge_dom  
IPR036811  Ubol_cytC_Rdtase_hinge_dom_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
GO:1902600  P:proton transmembrane transport  
KEGG pgr:PGTG_10719  -  
Pfam View protein in Pfam  
PF02320  UCR_hinge  
Amino Acid Sequences MTNSNSSSSSSPSTSSSPSTTSFTEVCSNVASAITQYFTPTVSAEAKQDSEEEKEGGEEEEEEEEEDEPEDPAPAIREECTESKCSKYKRHFDHCQERVLGGKGDKGEDCVEELFHLMHCVDECATPQVFSKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.25
4 0.24
5 0.25
6 0.27
7 0.25
8 0.25
9 0.23
10 0.23
11 0.25
12 0.22
13 0.21
14 0.19
15 0.18
16 0.14
17 0.14
18 0.12
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.1
29 0.11
30 0.12
31 0.12
32 0.14
33 0.14
34 0.14
35 0.14
36 0.13
37 0.14
38 0.14
39 0.13
40 0.11
41 0.11
42 0.11
43 0.1
44 0.09
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.07
65 0.1
66 0.13
67 0.15
68 0.17
69 0.18
70 0.22
71 0.28
72 0.32
73 0.38
74 0.45
75 0.53
76 0.6
77 0.68
78 0.73
79 0.78
80 0.84
81 0.78
82 0.74
83 0.65
84 0.56
85 0.49
86 0.42
87 0.34
88 0.24
89 0.23
90 0.19
91 0.2
92 0.2
93 0.19
94 0.18
95 0.16
96 0.17
97 0.14
98 0.14
99 0.12
100 0.13
101 0.1
102 0.09
103 0.1
104 0.08
105 0.08
106 0.08
107 0.1
108 0.1
109 0.1
110 0.12
111 0.15
112 0.15
113 0.15
114 0.17