Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KH63

Protein Details
Accession E3KH63   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-127GVKNWCKSATKKESKKRKQATPNNSGQQVHydrophilic
NLS Segment(s)
PositionSequence
112-115SKKR
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
KEGG pgr:PGTG_09351  -  
Amino Acid Sequences MRQIRKTMQTSLVNSNCIESGLNCQHNCDRGGCTITPTEEVMIERRRSTVKRSEVIHNDDDNYVINSASLSAQVSHRKILGLNFAALQPLDWINALHDGVKNWCKSATKKESKKRKQATPNNSGQQVDPRLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.32
4 0.26
5 0.22
6 0.13
7 0.18
8 0.24
9 0.3
10 0.28
11 0.32
12 0.34
13 0.37
14 0.38
15 0.31
16 0.26
17 0.23
18 0.27
19 0.23
20 0.23
21 0.21
22 0.21
23 0.2
24 0.18
25 0.16
26 0.13
27 0.13
28 0.16
29 0.2
30 0.2
31 0.19
32 0.21
33 0.25
34 0.25
35 0.3
36 0.34
37 0.35
38 0.39
39 0.42
40 0.47
41 0.49
42 0.52
43 0.5
44 0.42
45 0.37
46 0.31
47 0.28
48 0.21
49 0.16
50 0.11
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.05
59 0.08
60 0.13
61 0.14
62 0.14
63 0.14
64 0.14
65 0.15
66 0.16
67 0.18
68 0.15
69 0.14
70 0.14
71 0.14
72 0.14
73 0.13
74 0.12
75 0.07
76 0.07
77 0.06
78 0.06
79 0.06
80 0.07
81 0.09
82 0.09
83 0.09
84 0.1
85 0.11
86 0.16
87 0.21
88 0.21
89 0.2
90 0.23
91 0.26
92 0.3
93 0.4
94 0.46
95 0.51
96 0.61
97 0.71
98 0.79
99 0.85
100 0.92
101 0.9
102 0.89
103 0.9
104 0.9
105 0.9
106 0.88
107 0.88
108 0.85
109 0.79
110 0.7
111 0.61
112 0.58