Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3LA17

Protein Details
Accession E3LA17    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-53QPPNNPASKRSHKKKTGSKVDNTTKHydrophilic
NLS Segment(s)
PositionSequence
38-43RSHKKK
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 8, cyto 3
Family & Domain DBs
KEGG pgr:PGTG_19410  -  
Amino Acid Sequences MAGPTTADQPVPPTSTTNTTCVIPGLSSQPPNNPASKRSHKKKTGSKVDNTTKAVARVPAFVDEPNELTEPAPAPLITSMPKPLNGLTPSAPPASASVSILPVQQQHIGGYESSTAPLNKDQKRAITSKPALEATVKELQDLLKILEEDEKLDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.29
3 0.31
4 0.3
5 0.29
6 0.27
7 0.26
8 0.24
9 0.21
10 0.15
11 0.14
12 0.16
13 0.18
14 0.21
15 0.22
16 0.26
17 0.29
18 0.31
19 0.35
20 0.33
21 0.33
22 0.39
23 0.48
24 0.54
25 0.6
26 0.68
27 0.71
28 0.79
29 0.84
30 0.86
31 0.86
32 0.83
33 0.81
34 0.8
35 0.8
36 0.77
37 0.7
38 0.62
39 0.52
40 0.46
41 0.4
42 0.33
43 0.25
44 0.2
45 0.18
46 0.17
47 0.16
48 0.15
49 0.15
50 0.13
51 0.13
52 0.12
53 0.12
54 0.1
55 0.1
56 0.1
57 0.09
58 0.08
59 0.08
60 0.06
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.1
67 0.1
68 0.11
69 0.11
70 0.11
71 0.15
72 0.15
73 0.16
74 0.14
75 0.16
76 0.17
77 0.16
78 0.16
79 0.11
80 0.11
81 0.12
82 0.11
83 0.1
84 0.09
85 0.1
86 0.11
87 0.11
88 0.11
89 0.1
90 0.1
91 0.11
92 0.11
93 0.1
94 0.11
95 0.12
96 0.11
97 0.11
98 0.11
99 0.09
100 0.1
101 0.11
102 0.1
103 0.11
104 0.18
105 0.26
106 0.29
107 0.34
108 0.37
109 0.41
110 0.46
111 0.48
112 0.46
113 0.48
114 0.47
115 0.45
116 0.47
117 0.42
118 0.38
119 0.36
120 0.33
121 0.28
122 0.31
123 0.27
124 0.23
125 0.23
126 0.22
127 0.23
128 0.23
129 0.18
130 0.14
131 0.15
132 0.15
133 0.19
134 0.19
135 0.18