Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KR87

Protein Details
Accession E3KR87   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-33RPQNNEKKTTHKRTKDGTGDBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013174  DPM3  
Gene Ontology GO:0033185  C:dolichol-phosphate-mannose synthase complex  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
GO:0006486  P:protein glycosylation  
KEGG pgr:PGTG_13194  -  
Pfam View protein in Pfam  
PF08285  DPM3  
Amino Acid Sequences MYNLTITTSTPSLRPQNNEKKTTHKRTKDGTGDSRETWLRRLHLTLDQPTKPGPETDRIFARLLGPSITPPSSSSSLTTTIPPKEIELQLSNVPIGLSVVVFGAVCLTKILLDISISNHPKIHEEAYQELLSDIRMAKEDLRSKGISVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.56
4 0.63
5 0.68
6 0.64
7 0.67
8 0.72
9 0.77
10 0.77
11 0.75
12 0.74
13 0.75
14 0.82
15 0.79
16 0.77
17 0.74
18 0.71
19 0.66
20 0.6
21 0.57
22 0.5
23 0.43
24 0.38
25 0.34
26 0.28
27 0.26
28 0.27
29 0.26
30 0.28
31 0.33
32 0.36
33 0.39
34 0.37
35 0.36
36 0.35
37 0.34
38 0.28
39 0.25
40 0.2
41 0.22
42 0.23
43 0.26
44 0.28
45 0.29
46 0.29
47 0.27
48 0.25
49 0.19
50 0.17
51 0.14
52 0.12
53 0.09
54 0.11
55 0.11
56 0.1
57 0.1
58 0.13
59 0.14
60 0.14
61 0.14
62 0.14
63 0.16
64 0.16
65 0.17
66 0.17
67 0.16
68 0.17
69 0.16
70 0.15
71 0.17
72 0.17
73 0.18
74 0.16
75 0.17
76 0.17
77 0.17
78 0.16
79 0.12
80 0.11
81 0.08
82 0.07
83 0.05
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.05
99 0.06
100 0.06
101 0.09
102 0.18
103 0.2
104 0.2
105 0.22
106 0.22
107 0.24
108 0.26
109 0.26
110 0.22
111 0.24
112 0.26
113 0.29
114 0.29
115 0.26
116 0.24
117 0.2
118 0.17
119 0.15
120 0.13
121 0.09
122 0.1
123 0.12
124 0.14
125 0.23
126 0.29
127 0.31
128 0.36
129 0.36