Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3K393

Protein Details
Accession E3K393    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-106QNPKPPCKTPDQPPRTQRRIPRPSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
KEGG pgr:PGTG_04906  -  
Amino Acid Sequences MPLNAPQGFSGLLNASQGPRSTAKRPRTPQCAPRILKTPPSAPQGPQTTCQSAPEPSRGPSEHPAASSKPQNPKKRGVEDLQNPKPPCKTPDQPPRTQRRIPRPSEPSEPQNPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.14
5 0.15
6 0.19
7 0.23
8 0.3
9 0.38
10 0.46
11 0.54
12 0.63
13 0.68
14 0.73
15 0.76
16 0.77
17 0.77
18 0.78
19 0.71
20 0.67
21 0.64
22 0.58
23 0.56
24 0.51
25 0.45
26 0.41
27 0.44
28 0.41
29 0.35
30 0.4
31 0.39
32 0.37
33 0.37
34 0.35
35 0.32
36 0.3
37 0.31
38 0.26
39 0.23
40 0.23
41 0.24
42 0.22
43 0.2
44 0.23
45 0.22
46 0.24
47 0.24
48 0.26
49 0.22
50 0.22
51 0.23
52 0.22
53 0.25
54 0.27
55 0.29
56 0.36
57 0.44
58 0.52
59 0.55
60 0.62
61 0.66
62 0.66
63 0.66
64 0.61
65 0.61
66 0.62
67 0.68
68 0.66
69 0.65
70 0.61
71 0.58
72 0.58
73 0.51
74 0.46
75 0.44
76 0.44
77 0.47
78 0.57
79 0.62
80 0.68
81 0.75
82 0.81
83 0.8
84 0.8
85 0.79
86 0.79
87 0.81
88 0.79
89 0.79
90 0.76
91 0.75
92 0.77
93 0.74
94 0.7