Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6QUW1

Protein Details
Accession H6QUW1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-26FEGEGGKKRKQNRRPTTSSSICLHydrophilic
NLS Segment(s)
PositionSequence
10-13KKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG pgr:PGTG_22532  -  
Amino Acid Sequences MPPFEGEGGKKRKQNRRPTTSSSICLSKSLRLKKEHVLSSALAICSEDLTHLQSSSSTTEDTFYPLADSPDCDFNVGDEPTEDQQHLPNPQVQLLADYLRTESYRRKKLLEEELWEAVYRKMFKWFHQCAAKTSNWGDQLCWDNTVWMPKSLIKSCGPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.8
4 0.82
5 0.85
6 0.85
7 0.8
8 0.74
9 0.67
10 0.6
11 0.51
12 0.47
13 0.4
14 0.37
15 0.39
16 0.44
17 0.47
18 0.48
19 0.51
20 0.55
21 0.62
22 0.59
23 0.53
24 0.47
25 0.4
26 0.38
27 0.37
28 0.29
29 0.21
30 0.16
31 0.14
32 0.11
33 0.11
34 0.08
35 0.06
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.1
42 0.11
43 0.11
44 0.09
45 0.09
46 0.1
47 0.1
48 0.12
49 0.11
50 0.09
51 0.09
52 0.1
53 0.1
54 0.09
55 0.11
56 0.1
57 0.13
58 0.13
59 0.12
60 0.11
61 0.11
62 0.14
63 0.12
64 0.11
65 0.08
66 0.1
67 0.1
68 0.11
69 0.1
70 0.07
71 0.09
72 0.11
73 0.12
74 0.12
75 0.14
76 0.14
77 0.15
78 0.15
79 0.13
80 0.12
81 0.12
82 0.11
83 0.09
84 0.08
85 0.08
86 0.08
87 0.09
88 0.1
89 0.18
90 0.27
91 0.35
92 0.36
93 0.38
94 0.41
95 0.48
96 0.56
97 0.53
98 0.49
99 0.45
100 0.44
101 0.42
102 0.39
103 0.32
104 0.23
105 0.22
106 0.19
107 0.15
108 0.22
109 0.24
110 0.29
111 0.39
112 0.42
113 0.46
114 0.53
115 0.54
116 0.5
117 0.54
118 0.5
119 0.44
120 0.42
121 0.4
122 0.37
123 0.36
124 0.32
125 0.31
126 0.36
127 0.32
128 0.32
129 0.26
130 0.22
131 0.24
132 0.31
133 0.28
134 0.24
135 0.25
136 0.27
137 0.35
138 0.37
139 0.4