Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KC82

Protein Details
Accession E3KC82   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-47ADPVGSRRGRRPKLKKDLHLRVESKBasic
NLS Segment(s)
PositionSequence
29-38RRGRRPKLKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
KEGG pgr:PGTG_08267  -  
Amino Acid Sequences MDDSLLDQMTQVVELLPRYESAADPVGSRRGRRPKLKKDLHLRVESKILTLRELYLRVYDLSGIVTHPRIWTLQRQSNSTPQVNHGTPPVPRPTSQGRLRHRLTRELDRDIDDLILSFSLLSLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.1
6 0.11
7 0.11
8 0.13
9 0.16
10 0.15
11 0.15
12 0.17
13 0.24
14 0.25
15 0.27
16 0.33
17 0.4
18 0.48
19 0.58
20 0.67
21 0.7
22 0.79
23 0.86
24 0.86
25 0.86
26 0.88
27 0.85
28 0.82
29 0.73
30 0.64
31 0.59
32 0.5
33 0.4
34 0.34
35 0.27
36 0.19
37 0.18
38 0.17
39 0.14
40 0.15
41 0.14
42 0.11
43 0.11
44 0.1
45 0.1
46 0.09
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.16
59 0.23
60 0.29
61 0.3
62 0.34
63 0.36
64 0.43
65 0.47
66 0.42
67 0.36
68 0.33
69 0.37
70 0.34
71 0.32
72 0.27
73 0.24
74 0.22
75 0.26
76 0.29
77 0.25
78 0.25
79 0.29
80 0.35
81 0.41
82 0.48
83 0.53
84 0.54
85 0.61
86 0.65
87 0.68
88 0.64
89 0.64
90 0.63
91 0.64
92 0.62
93 0.59
94 0.57
95 0.53
96 0.5
97 0.41
98 0.35
99 0.25
100 0.19
101 0.14
102 0.11
103 0.07
104 0.06
105 0.05