Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HFH4

Protein Details
Accession Q2HFH4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-74DMCRRYGWKPFRPKDPSKPRKVYDBasic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 8, golg 3, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006813  Glyco_trans_17  
Gene Ontology GO:0016020  C:membrane  
GO:0003830  F:beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity  
GO:0006487  P:protein N-linked glycosylation  
Pfam View protein in Pfam  
PF04724  Glyco_transf_17  
Amino Acid Sequences MSRRTRQLWRWVRVTAVLGVIWLVLSVAHGNGSDSNPLAPTWASRDDNPLDMCRRYGWKPFRPKDPSKPRKVYDLMMFNTELDHLEIRLNSTWDEVDYFVIVEGSKTFTNHAKPLTLKRHLPDFKPYHSKIIYHEIVYPPNFKPRTTWDMEDLQRNSMLTQVFPHLSGRQAPQHGDVLVVSDVDEVPRPETLRVLRACAFPRRLTLSSRFYYYSFQWLHRGPEWPHPQATFYQGMLKTLRPNDLRIADGGMWPFREKGYSLSQHGNSQHTSVAGSSVWATTWTWNGRFEVVIKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.41
3 0.32
4 0.24
5 0.18
6 0.16
7 0.14
8 0.1
9 0.07
10 0.05
11 0.03
12 0.04
13 0.05
14 0.05
15 0.05
16 0.06
17 0.07
18 0.09
19 0.11
20 0.12
21 0.12
22 0.12
23 0.13
24 0.12
25 0.13
26 0.11
27 0.11
28 0.15
29 0.21
30 0.23
31 0.23
32 0.3
33 0.3
34 0.35
35 0.35
36 0.36
37 0.33
38 0.32
39 0.32
40 0.29
41 0.32
42 0.31
43 0.39
44 0.43
45 0.48
46 0.59
47 0.64
48 0.71
49 0.75
50 0.8
51 0.81
52 0.83
53 0.84
54 0.83
55 0.86
56 0.78
57 0.77
58 0.72
59 0.66
60 0.62
61 0.6
62 0.5
63 0.44
64 0.42
65 0.33
66 0.3
67 0.25
68 0.18
69 0.11
70 0.1
71 0.08
72 0.09
73 0.09
74 0.11
75 0.12
76 0.12
77 0.11
78 0.12
79 0.11
80 0.1
81 0.11
82 0.09
83 0.08
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.07
92 0.07
93 0.08
94 0.1
95 0.13
96 0.16
97 0.19
98 0.2
99 0.2
100 0.23
101 0.31
102 0.38
103 0.39
104 0.39
105 0.38
106 0.47
107 0.47
108 0.46
109 0.48
110 0.44
111 0.45
112 0.5
113 0.5
114 0.46
115 0.44
116 0.43
117 0.36
118 0.4
119 0.35
120 0.27
121 0.29
122 0.24
123 0.26
124 0.26
125 0.26
126 0.19
127 0.26
128 0.25
129 0.23
130 0.23
131 0.26
132 0.32
133 0.32
134 0.33
135 0.28
136 0.33
137 0.35
138 0.39
139 0.34
140 0.28
141 0.25
142 0.24
143 0.2
144 0.16
145 0.15
146 0.09
147 0.09
148 0.1
149 0.1
150 0.11
151 0.12
152 0.1
153 0.11
154 0.13
155 0.15
156 0.17
157 0.18
158 0.19
159 0.19
160 0.2
161 0.19
162 0.17
163 0.14
164 0.12
165 0.1
166 0.09
167 0.07
168 0.06
169 0.06
170 0.06
171 0.07
172 0.06
173 0.07
174 0.08
175 0.09
176 0.09
177 0.13
178 0.14
179 0.19
180 0.2
181 0.23
182 0.24
183 0.27
184 0.3
185 0.34
186 0.36
187 0.3
188 0.33
189 0.36
190 0.35
191 0.36
192 0.39
193 0.39
194 0.37
195 0.39
196 0.37
197 0.32
198 0.33
199 0.3
200 0.32
201 0.27
202 0.27
203 0.3
204 0.3
205 0.34
206 0.33
207 0.38
208 0.32
209 0.4
210 0.46
211 0.44
212 0.44
213 0.4
214 0.4
215 0.35
216 0.37
217 0.29
218 0.22
219 0.26
220 0.24
221 0.26
222 0.26
223 0.26
224 0.28
225 0.28
226 0.35
227 0.3
228 0.32
229 0.36
230 0.36
231 0.35
232 0.3
233 0.31
234 0.24
235 0.24
236 0.24
237 0.19
238 0.18
239 0.18
240 0.18
241 0.15
242 0.16
243 0.15
244 0.17
245 0.24
246 0.29
247 0.32
248 0.39
249 0.41
250 0.45
251 0.48
252 0.47
253 0.4
254 0.35
255 0.32
256 0.25
257 0.23
258 0.18
259 0.16
260 0.12
261 0.11
262 0.11
263 0.1
264 0.09
265 0.1
266 0.1
267 0.11
268 0.18
269 0.22
270 0.24
271 0.26
272 0.28
273 0.28
274 0.29
275 0.29