Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3LAV1

Protein Details
Accession E3LAV1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
154-181HSSSTKTFTKKTPRKKVKRDPPTKPVDLHydrophilic
NLS Segment(s)
PositionSequence
163-174KKTPRKKVKRDP
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
KEGG pgr:PGTG_19337  -  
Amino Acid Sequences MDLPYSGSDTSESHTDSGDTVPHRCDGTPPATTTILAQNFQIGSETTAPIHHPPSFQEFAHKANKATSSAPLVPSEPVLDTEIQQISADEFNRNMKAAEQATRGLRNLKLPRSLKEKVKSLEKSLVSTKRTWEETGEIPDDEAIKIHQGPTSAHSSSTKTFTKKTPRKKVKRDPPTKPVDLLNKELPHPPANPLPSTTSNRPMDQTVATSQSTPSIISGAPCEPGSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.16
5 0.18
6 0.17
7 0.18
8 0.19
9 0.21
10 0.21
11 0.21
12 0.23
13 0.24
14 0.26
15 0.28
16 0.28
17 0.3
18 0.3
19 0.29
20 0.28
21 0.3
22 0.28
23 0.24
24 0.22
25 0.2
26 0.2
27 0.2
28 0.19
29 0.12
30 0.12
31 0.13
32 0.14
33 0.11
34 0.12
35 0.14
36 0.16
37 0.19
38 0.18
39 0.16
40 0.18
41 0.25
42 0.27
43 0.25
44 0.3
45 0.29
46 0.32
47 0.39
48 0.38
49 0.31
50 0.32
51 0.35
52 0.29
53 0.29
54 0.26
55 0.24
56 0.24
57 0.25
58 0.22
59 0.21
60 0.19
61 0.18
62 0.16
63 0.11
64 0.1
65 0.11
66 0.1
67 0.1
68 0.13
69 0.12
70 0.12
71 0.11
72 0.1
73 0.1
74 0.11
75 0.11
76 0.09
77 0.1
78 0.12
79 0.13
80 0.13
81 0.12
82 0.1
83 0.14
84 0.15
85 0.17
86 0.16
87 0.18
88 0.2
89 0.21
90 0.21
91 0.2
92 0.19
93 0.24
94 0.27
95 0.28
96 0.34
97 0.34
98 0.38
99 0.43
100 0.46
101 0.46
102 0.46
103 0.49
104 0.44
105 0.5
106 0.48
107 0.44
108 0.47
109 0.4
110 0.38
111 0.38
112 0.41
113 0.35
114 0.34
115 0.33
116 0.3
117 0.32
118 0.3
119 0.25
120 0.22
121 0.22
122 0.24
123 0.23
124 0.19
125 0.17
126 0.17
127 0.16
128 0.13
129 0.1
130 0.07
131 0.07
132 0.07
133 0.08
134 0.08
135 0.09
136 0.1
137 0.13
138 0.18
139 0.17
140 0.18
141 0.19
142 0.21
143 0.22
144 0.26
145 0.28
146 0.25
147 0.28
148 0.35
149 0.45
150 0.51
151 0.6
152 0.66
153 0.73
154 0.81
155 0.89
156 0.93
157 0.93
158 0.94
159 0.94
160 0.92
161 0.9
162 0.88
163 0.8
164 0.71
165 0.66
166 0.64
167 0.58
168 0.54
169 0.52
170 0.45
171 0.44
172 0.46
173 0.43
174 0.37
175 0.34
176 0.33
177 0.33
178 0.34
179 0.34
180 0.32
181 0.34
182 0.37
183 0.43
184 0.44
185 0.46
186 0.47
187 0.47
188 0.47
189 0.43
190 0.4
191 0.34
192 0.32
193 0.27
194 0.27
195 0.26
196 0.24
197 0.22
198 0.22
199 0.21
200 0.18
201 0.15
202 0.13
203 0.12
204 0.13
205 0.16
206 0.14
207 0.16