Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KGR9

Protein Details
Accession E3KGR9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-49KQIKKHSELLKEKRRSRKTRERSLIVBasic
NLS Segment(s)
PositionSequence
27-44KKHSELLKEKRRSRKTRE
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
KEGG pgr:PGTG_08680  -  
Amino Acid Sequences MFKIFRLISKIYLFVSAVRKLDLKQIKKHSELLKEKRRSRKTRERSLIVKLTDPCGDFYPKKTIQNLLMGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.24
4 0.23
5 0.22
6 0.22
7 0.21
8 0.3
9 0.34
10 0.35
11 0.4
12 0.49
13 0.52
14 0.54
15 0.6
16 0.56
17 0.58
18 0.62
19 0.63
20 0.64
21 0.68
22 0.72
23 0.76
24 0.81
25 0.78
26 0.79
27 0.8
28 0.8
29 0.82
30 0.84
31 0.8
32 0.74
33 0.74
34 0.71
35 0.61
36 0.56
37 0.46
38 0.41
39 0.37
40 0.33
41 0.28
42 0.24
43 0.29
44 0.25
45 0.28
46 0.34
47 0.36
48 0.41
49 0.42
50 0.44
51 0.43