Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KQS1

Protein Details
Accession E3KQS1    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-171PSGACFRCVKRDQNKNKFTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 10.833, nucl 9, cyto_nucl 8.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0003727  F:single-stranded RNA binding  
GO:0045182  F:translation regulator activity  
GO:0008270  F:zinc ion binding  
GO:2000767  P:positive regulation of cytoplasmic translation  
KEGG pgr:PGTG_13028  -  
Amino Acid Sequences MAKWLLEHKHSWTHLADPNFKTPMATYTVMIHSVPTEFEANNNNHLKKLCAQNDIPYDMIEKARWLGQPLKNGKQHGTLLINVKDKKLTQDITRGSLIIDGTLLTASRYTPGPPQCFNCLEMGHPAFYCKTPPLCARCGGKHNSKDCQIENPSGACFRCVKRDQNKNKFTSLTDIKYTHSPFSIQCPLKSIEVNKNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.48
4 0.43
5 0.48
6 0.45
7 0.43
8 0.38
9 0.32
10 0.29
11 0.26
12 0.23
13 0.19
14 0.2
15 0.22
16 0.22
17 0.21
18 0.19
19 0.14
20 0.13
21 0.12
22 0.11
23 0.11
24 0.1
25 0.12
26 0.18
27 0.2
28 0.27
29 0.33
30 0.31
31 0.32
32 0.33
33 0.33
34 0.32
35 0.4
36 0.37
37 0.37
38 0.38
39 0.42
40 0.45
41 0.44
42 0.39
43 0.29
44 0.26
45 0.22
46 0.22
47 0.15
48 0.12
49 0.11
50 0.13
51 0.14
52 0.15
53 0.22
54 0.24
55 0.33
56 0.38
57 0.45
58 0.46
59 0.47
60 0.46
61 0.42
62 0.39
63 0.35
64 0.31
65 0.26
66 0.27
67 0.29
68 0.33
69 0.29
70 0.29
71 0.27
72 0.25
73 0.25
74 0.25
75 0.23
76 0.19
77 0.26
78 0.27
79 0.29
80 0.28
81 0.25
82 0.21
83 0.2
84 0.17
85 0.09
86 0.08
87 0.05
88 0.04
89 0.04
90 0.04
91 0.03
92 0.03
93 0.04
94 0.05
95 0.05
96 0.06
97 0.12
98 0.18
99 0.21
100 0.24
101 0.26
102 0.3
103 0.31
104 0.31
105 0.27
106 0.22
107 0.19
108 0.22
109 0.2
110 0.17
111 0.15
112 0.15
113 0.14
114 0.14
115 0.15
116 0.13
117 0.14
118 0.17
119 0.23
120 0.26
121 0.28
122 0.33
123 0.36
124 0.38
125 0.43
126 0.46
127 0.49
128 0.52
129 0.55
130 0.56
131 0.57
132 0.57
133 0.51
134 0.53
135 0.48
136 0.43
137 0.4
138 0.36
139 0.31
140 0.3
141 0.28
142 0.22
143 0.23
144 0.21
145 0.29
146 0.33
147 0.41
148 0.48
149 0.59
150 0.68
151 0.75
152 0.82
153 0.76
154 0.76
155 0.69
156 0.6
157 0.59
158 0.55
159 0.48
160 0.45
161 0.42
162 0.4
163 0.45
164 0.45
165 0.39
166 0.33
167 0.3
168 0.26
169 0.33
170 0.4
171 0.36
172 0.34
173 0.37
174 0.38
175 0.39
176 0.43
177 0.41