Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H1M3

Protein Details
Accession Q2H1M3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-35RDRQPKTSWRERIKPDWPAPHydrophilic
223-242LTPEEKAARRDWRKLQRQEQHydrophilic
NLS Segment(s)
PositionSequence
215-233PPPRVRARLTPEEKAARRD
Subcellular Location(s) mito 13, cyto 7, nucl 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000814  TBP  
IPR012295  TBP_dom_sf  
IPR033710  TBP_eukaryotic  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF00352  TBP  
CDD cd04516  TBP_eukaryotes  
Amino Acid Sequences MPPNVQTRSGAERELRDRQPKTSWRERIKPDWPAPIIQNVVATVDLGCRLDLRLISEQARNVEYNRRKFHALIMRIREPRTTTLVFSSGKMVITGAKSEALAKLAARKHARALQKCGFGTGFSDFKVQNYVGSATCDFLIRLERIAHMYRESAMYEPELFPGLVYTMLRPKLKCLVFSTGKIVLTGAKAVEDIQEAFANLYPLLLEAKVAGSKAPPPRVRARLTPEEKAARRDWRKLQRQEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.56
4 0.57
5 0.57
6 0.62
7 0.64
8 0.66
9 0.68
10 0.7
11 0.7
12 0.77
13 0.79
14 0.79
15 0.79
16 0.8
17 0.75
18 0.74
19 0.66
20 0.61
21 0.55
22 0.51
23 0.44
24 0.35
25 0.3
26 0.21
27 0.2
28 0.16
29 0.14
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.07
36 0.08
37 0.09
38 0.1
39 0.13
40 0.16
41 0.19
42 0.22
43 0.24
44 0.25
45 0.26
46 0.27
47 0.24
48 0.22
49 0.29
50 0.35
51 0.41
52 0.44
53 0.45
54 0.45
55 0.45
56 0.51
57 0.5
58 0.49
59 0.48
60 0.5
61 0.55
62 0.56
63 0.56
64 0.5
65 0.43
66 0.39
67 0.37
68 0.31
69 0.25
70 0.23
71 0.26
72 0.24
73 0.22
74 0.22
75 0.17
76 0.16
77 0.14
78 0.12
79 0.1
80 0.1
81 0.1
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.12
91 0.14
92 0.2
93 0.21
94 0.22
95 0.24
96 0.3
97 0.38
98 0.36
99 0.42
100 0.41
101 0.44
102 0.43
103 0.41
104 0.35
105 0.27
106 0.24
107 0.19
108 0.15
109 0.1
110 0.12
111 0.11
112 0.11
113 0.13
114 0.12
115 0.1
116 0.1
117 0.11
118 0.1
119 0.12
120 0.12
121 0.1
122 0.1
123 0.1
124 0.08
125 0.08
126 0.1
127 0.08
128 0.1
129 0.1
130 0.1
131 0.13
132 0.15
133 0.15
134 0.13
135 0.14
136 0.13
137 0.13
138 0.14
139 0.11
140 0.1
141 0.1
142 0.11
143 0.1
144 0.1
145 0.1
146 0.09
147 0.08
148 0.08
149 0.07
150 0.07
151 0.07
152 0.07
153 0.11
154 0.16
155 0.19
156 0.19
157 0.22
158 0.29
159 0.31
160 0.32
161 0.31
162 0.35
163 0.36
164 0.38
165 0.39
166 0.34
167 0.33
168 0.3
169 0.26
170 0.19
171 0.17
172 0.16
173 0.11
174 0.08
175 0.08
176 0.08
177 0.09
178 0.09
179 0.09
180 0.09
181 0.1
182 0.1
183 0.1
184 0.11
185 0.11
186 0.09
187 0.09
188 0.07
189 0.07
190 0.08
191 0.07
192 0.06
193 0.06
194 0.08
195 0.09
196 0.09
197 0.09
198 0.09
199 0.16
200 0.24
201 0.33
202 0.35
203 0.41
204 0.5
205 0.57
206 0.61
207 0.63
208 0.64
209 0.65
210 0.68
211 0.67
212 0.66
213 0.68
214 0.66
215 0.64
216 0.62
217 0.62
218 0.63
219 0.66
220 0.69
221 0.7
222 0.77